Sequence 1: | NP_572815.3 | Gene: | CG11085 / 32213 | FlyBaseID: | FBgn0030408 | Length: | 295 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_034261.1 | Gene: | Emx1 / 13796 | MGIID: | 95387 | Length: | 257 | Species: | Mus musculus |
Alignment Length: | 238 | Identity: | 75/238 - (31%) |
---|---|---|---|
Similarity: | 99/238 - (41%) | Gaps: | 79/238 - (33%) |
- Green bases have known domain annotations that are detailed below.
Fly 61 RRFTHHDESSVESCLSATRGPGSGTGSGGGGGGGGGGGVASGLS-------------AAAAAAGV 112
Fly 113 AAGLLAAAASGANGDRDANGGS---------------GPGSGGGTS------------------- 143
Fly 144 ------GGYAEHKLQLS---KSG--------RKPRRRRTAFTHAQLAYLERKFRCQKYLSVADRS 191
Fly 192 DVAETLNLSETQVKTWYQNRRTKWKRQNQLRLEQLRHQATMEK 234 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG11085 | NP_572815.3 | Homeobox | 163..216 | CDD:278475 | 29/52 (56%) |
Emx1 | NP_034261.1 | COG5576 | 108..>218 | CDD:227863 | 40/112 (36%) |
Homeobox | 163..215 | CDD:278475 | 29/51 (57%) | ||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 216..257 | 5/18 (28%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.910 |