Sequence 1: | NP_572815.3 | Gene: | CG11085 / 32213 | FlyBaseID: | FBgn0030408 | Length: | 295 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001129743.2 | Gene: | NKX2-6 / 137814 | HGNCID: | 32940 | Length: | 301 | Species: | Homo sapiens |
Alignment Length: | 243 | Identity: | 78/243 - (32%) |
---|---|---|---|
Similarity: | 101/243 - (41%) | Gaps: | 45/243 - (18%) |
- Green bases have known domain annotations that are detailed below.
Fly 82 GSGTGSGGGGGGG--------GGGGVASGLSAAAAAAGVAAGLLAAAASGANGDRDANGGSGPGS 138
Fly 139 GGGTSGGYAEHKLQLSKSGRKPRRRRTAFTHAQLAYLERKFRCQKYLSVADRSDVAETLNLSETQ 203
Fly 204 VKTWYQNRRTKWKRQNQLR-LEQLRHQATMEK---DFVVQDGGGAGGLGCCPSGLSSSFSAAAAA 264
Fly 265 --------------------AAAASNPCNFLTSAAAAAIFRNVGYVHG 292 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG11085 | NP_572815.3 | Homeobox | 163..216 | CDD:278475 | 26/52 (50%) |
NKX2-6 | NP_001129743.2 | Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 22..135 | 26/88 (30%) | |
HOX | 132..188 | CDD:197696 | 27/55 (49%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.910 |