DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment CG11085 and Dlx1

DIOPT Version :9

Sequence 1:	NP_572815.3	Gene:	CG11085 / 32213	FlyBaseID:	FBgn0030408	Length:	295	Species:	Drosophila melanogaster
Sequence 2:	NP_034183.1	Gene:	Dlx1 / 13390	MGIID:	94901	Length:	255	Species:	Mus musculus

Alignment Length:	136	Identity:	39/136 - (28%)
Similarity:	69/136 - (50%)	Gaps:	28/136 - (20%)

- Green bases have known domain annotations that are detailed below.

  Fly   136 PGSGGGTSGGYAEHKLQLSKSGRKPRRRRTAFTHAQLAYLERKFRCQKYLSVADRSDVAETLNLS 200
            ||:....|......:::.:..|:|.|:.||.::..||..|.|:|:..:||::.:|:::|.:|.|:
Mouse   104 PGADSEKSTVVEGGEVRFNGKGKKIRKPRTIYSSLQLQALNRRFQQTQYLALPERAELAASLGLT 168

  Fly   201 ETQVKTWYQNRRTKWKRQNQLRLEQLRHQATMEKDFVVQDGGGAGGLGCCPSGLSSSFSAAAAAA 265
            :||||.|:||:|:|:|:                   :::.||.|         |..|..|...|.
Mouse   169 QTQVKIWFQNKRSKFKK-------------------LMKQGGAA---------LEGSALANGRAL 205

  Fly   266 AAASNP 271
            :|.|.|
Mouse   206 SAGSPP 211

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
CG11085	NP_572815.3	Homeobox	163..216	CDD:278475	22/52 (42%)
Dlx1	NP_034183.1	Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	1..38
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	95..118		3/13 (23%)
		Homeobox	131..185	CDD:395001	22/53 (42%)
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	204..233		4/8 (50%)
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	1	0.910	-	-
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
	1	0.910