Sequence 1: | NP_572815.3 | Gene: | CG11085 / 32213 | FlyBaseID: | FBgn0030408 | Length: | 295 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001005232.1 | Gene: | Dbx1 / 13172 | MGIID: | 94867 | Length: | 335 | Species: | Mus musculus |
Alignment Length: | 250 | Identity: | 62/250 - (24%) |
---|---|---|---|
Similarity: | 82/250 - (32%) | Gaps: | 89/250 - (35%) |
- Green bases have known domain annotations that are detailed below.
Fly 40 RSTPDSTAAGCQQELLLSHHHRRFTHHDESSVESCLSATRGP----------------------- 81
Fly 82 -GSGTGSGGGGGGGG--GGGVASGLSAAAAAAGVAAGLLAAAASGANGDRDANGGSGPGSGGGTS 143
Fly 144 GG-------------YAEHKLQ------------------------LSKSGRKPRR---RRTAFT 168
Fly 169 HAQLAYLERKFRCQKYLSVADRSDVAETLNLSETQVKTWYQNRRTKWKRQNQLRL 223 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG11085 | NP_572815.3 | Homeobox | 163..216 | CDD:278475 | 25/52 (48%) |
Dbx1 | NP_001005232.1 | Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 58..102 | 9/43 (21%) | |
Homeobox | 184..237 | CDD:278475 | 25/52 (48%) | ||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 240..335 | 0/4 (0%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_KOG0488 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.810 |