DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11085 and Dbx1

DIOPT Version :9

Sequence 1:NP_572815.3 Gene:CG11085 / 32213 FlyBaseID:FBgn0030408 Length:295 Species:Drosophila melanogaster
Sequence 2:NP_001005232.1 Gene:Dbx1 / 13172 MGIID:94867 Length:335 Species:Mus musculus


Alignment Length:250 Identity:62/250 - (24%)
Similarity:82/250 - (32%) Gaps:89/250 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly    40 RSTPDSTAAGCQQELLLSHHHRRFTHHDESSVESCLSATRGP----------------------- 81
            |.||..|.....|.        .|:.|....||..:..:|.|                       
Mouse    18 RPTPTLTLPQSLQS--------AFSGHSSFLVEDLIRISRPPTYLSRSIPAASLSPPSQEAPAAL 74

  Fly    82 -GSGTGSGGGGGGGG--GGGVASGLSAAAAAAGVAAGLLAAAASGANGDRDANGGSGPGSGGGTS 143
             .|||...|..|.|.  |....:.||.|:....:..|:.|..:|....:              ||
Mouse    75 ADSGTSDLGSPGSGSRRGSSPQTALSPASEPTFLKFGVNAILSSAPRRE--------------TS 125

  Fly   144 GG-------------YAEHKLQ------------------------LSKSGRKPRR---RRTAFT 168
            ..             |.|...|                        |:..| ||||   ||..|:
Mouse   126 PALLQSPPPKTFAFPYFEGSFQPFIRSSYFPASSSVVPIPGTFSWPLAARG-KPRRGMLRRAVFS 189

  Fly   169 HAQLAYLERKFRCQKYLSVADRSDVAETLNLSETQVKTWYQNRRTKWKRQNQLRL 223
            ..|...||:.|:.|||:|..||..:|..|.|.::|||.|:||||.||:...:..|
Mouse   190 DVQRKALEKTFQKQKYISKPDRKKLASKLGLKDSQVKIWFQNRRMKWRNSKEREL 244

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11085NP_572815.3 Homeobox 163..216 CDD:278475 25/52 (48%)
Dbx1NP_001005232.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 58..102 9/43 (21%)
Homeobox 184..237 CDD:278475 25/52 (48%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 240..335 0/4 (0%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0488
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.