DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11085 and Crx

DIOPT Version :9

Sequence 1:NP_572815.3 Gene:CG11085 / 32213 FlyBaseID:FBgn0030408 Length:295 Species:Drosophila melanogaster
Sequence 2:NP_001106801.1 Gene:Crx / 12951 MGIID:1194883 Length:323 Species:Mus musculus


Alignment Length:201 Identity:55/201 - (27%)
Similarity:75/201 - (37%) Gaps:54/201 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   118 AAAASGANGDRDANGGSGPGSGGGTSGGYAEHKLQLSKSGRKPRRRRTAFTHAQLAYLERKFRCQ 182
            |.|.||.|.|                  .....:..|.:.||.||.||.||.:||..||..|...
Mouse    39 ALALSGPNVD------------------LMHQAVPYSSAPRKQRRERTTFTRSQLEELEALFAKT 85

  Fly   183 KYLSVADRSDVAETLNLSETQVKTWYQNRRTKWKRQNQLRLEQLRHQATMEKDFVVQDGGGAG-- 245
            :|..|..|.:||..:||.|::|:.|::|||.|.::|.|.:.:|.:......|....:...|..  
Mouse    86 QYPDVYAREEVALKINLPESRVQVWFKNRRAKCRQQRQQQKQQQQPPGAQTKARPAKRKAGTSPR 150

  Fly   246 -GLGCC--PSGLSSSFS-----------------------------AAAAAAAAASNPCNFLTSA 278
             ....|  |.|:|.|:|                             .|..|...||.|.  ||||
Mouse   151 PSTDVCTDPLGISDSYSPSLPGPSGSPTTAVATVSIWSPASEAPLPEAQRAGLVASGPS--LTSA 213

  Fly   279 AAAAIF 284
            ..|..:
Mouse   214 PYAMTY 219

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11085NP_572815.3 Homeobox 163..216 CDD:278475 23/52 (44%)
CrxNP_001106801.1 Homeobox 67..117 CDD:278475 22/49 (45%)
TF_Otx 188..273 CDD:281521 10/34 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.