DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11085 and AgaP_AGAP007985

DIOPT Version :9

Sequence 1:NP_572815.3 Gene:CG11085 / 32213 FlyBaseID:FBgn0030408 Length:295 Species:Drosophila melanogaster
Sequence 2:XP_317481.4 Gene:AgaP_AGAP007985 / 1277963 VectorBaseID:AGAP007985 Length:354 Species:Anopheles gambiae


Alignment Length:208 Identity:56/208 - (26%)
Similarity:80/208 - (38%) Gaps:67/208 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly   118 AAAASGANGDRDANGGSGPGSGGG-----------TSGG--YAEHKLQLSKSGRKPRRRRTAFTH 169
            |....|:..:|.|:.|...||.||           ..||  :|..        ||.||.||.||.
Mosquito    32 ARPPQGSPLERSASTGQLMGSSGGDPNSPLSDPHSDDGGDDFAPK--------RKQRRYRTTFTS 88

  Fly   170 AQLAYLERKFRCQKYLSVADRSDVAETLNLSETQVKTWYQNRRTKWKRQNQLRLEQLRHQATMEK 234
            .||..||:.|....|..|..|.::|..:.|:|.:::.|:||||.||::|.::.            
Mosquito    89 FQLEELEKAFSRTHYPDVFTREELAMKIGLTEARIQVWFQNRRAKWRKQEKVG------------ 141

  Fly   235 DFVVQDGGGAGGLGCCPSG------LSSSFSAAAAAAAAASNPCNFLT----------SAAAAAI 283
                            |.|      |:|:....:|...|.|.|.|..:          .||:.|.
Mosquito   142 ----------------PQGHPYNPYLASAGQVPSATVVAPSLPPNPFSHLGFNLRKPFDAASLAA 190

  Fly   284 FR--NVGYVHGCP 294
            ||  ::|..|..|
Mosquito   191 FRYPSLGGSHMLP 203

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11085NP_572815.3 Homeobox 163..216 CDD:278475 21/52 (40%)
AgaP_AGAP007985XP_317481.4 Homeobox 83..135 CDD:278475 21/51 (41%)
OAR 321..338 CDD:281777
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.