DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11085 and AgaP_AGAP005727

DIOPT Version :9

Sequence 1:NP_572815.3 Gene:CG11085 / 32213 FlyBaseID:FBgn0030408 Length:295 Species:Drosophila melanogaster
Sequence 2:XP_315742.4 Gene:AgaP_AGAP005727 / 1276399 VectorBaseID:AGAP005727 Length:412 Species:Anopheles gambiae


Alignment Length:219 Identity:60/219 - (27%)
Similarity:80/219 - (36%) Gaps:91/219 - (41%)


- Green bases have known domain annotations that are detailed below.


  Fly    58 HHHRRFTH----HDESSVESCLSATRGP-GSGTGSGGGGGGGGGGGVASGLSAAAAAAGVAAGLL 117
            |||:..||    |.:..     ..|.|| ||.|       ||..|.:.:           :..|.
Mosquito    52 HHHQPGTHPLSPHQQQQ-----HLTVGPNGSPT-------GGHSGSLPN-----------SPELQ 93

  Fly   118 AAAASGANGDRDAN------------------------------------GGS-----GPGSG-- 139
            ..:|:| :|.||..                                    ||.     .||.|  
Mosquito    94 EPSATG-SGPRDNKIIAKPLPSRPTPFLHHSLNHPHLHSLLAHCRNPYMPGGPQVFPLPPGQGFP 157

  Fly   140 --GGTSGGYAEHKLQLSKSGRKPRR---RRTAFTHAQLAYLERKFRCQKYLSVADRSDVAETLNL 199
              ..|.|              ||||   ||..|:.:|...||::|:.|||:|..||..:||.|.|
Mosquito   158 WAHSTRG--------------KPRRGMMRRAVFSDSQRKGLEKRFQLQKYISKPDRKKLAERLGL 208

  Fly   200 SETQVKTWYQNRRTKWKRQNQLRL 223
            .::|||.|:||||.||:...:..|
Mosquito   209 KDSQVKIWFQNRRMKWRNSKEREL 232

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11085NP_572815.3 Homeobox 163..216 CDD:278475 26/52 (50%)
AgaP_AGAP005727XP_315742.4 Homeobox 172..225 CDD:278475 26/52 (50%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0488
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.