DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11085 and AgaP_AGAP003669

DIOPT Version :9

Sequence 1:NP_572815.3 Gene:CG11085 / 32213 FlyBaseID:FBgn0030408 Length:295 Species:Drosophila melanogaster
Sequence 2:XP_313452.4 Gene:AgaP_AGAP003669 / 1274345 VectorBaseID:AGAP003669 Length:373 Species:Anopheles gambiae


Alignment Length:264 Identity:89/264 - (33%)
Similarity:114/264 - (43%) Gaps:82/264 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 IRDLLGDLINRRQTDSELEL-------SN----DDSDIDIEDRSTPDSTAAGCQQELLLSHHHRR 62
            :|:|..|    |.||:...|       ||    :||.:||||          ..|||        
Mosquito   124 LRNLDPD----RHTDTPHSLLESDDYDSNHDEEEDSIVDIED----------MDQEL-------- 166

  Fly    63 FTHHDESSVESCLSATRGPGSGTGSGGGGGG---GGGGGVASGLSAAAAAAGVAA-----GLLAA 119
                .||..:        ||...|||..|..   |.|.|...|.:.||||..|..     ..|||
Mosquito   167 ----SESGSQ--------PGGRKGSGSPGSPSAMGMGHGSPPGAALAAAAGHVPIRPTPFSALAA 219

  Fly   120 AASGANGDRDANGG------------------SGPGSGGGTSGGYAEH-----KLQLSKSGRKPR 161
            ||:...|   .:||                  .|.|.|.|..||..|.     .|:..|..||| 
Mosquito   220 AAAAWGG---MSGGVPWPGARQMPPFGPPGLFPGQGFGAGQLGGDNEPPRIKCNLRKHKPNRKP- 280

  Fly   162 RRRTAFTHAQLAYLERKFRCQKYLSVADRSDVAETLNLSETQVKTWYQNRRTKWKRQNQLRLEQL 226
              ||.||..||..||:|||.::|||:|:|::.:.:|.|:|||||.|:||||.|.||..:..||::
Mosquito   281 --RTPFTTQQLLSLEKKFREKQYLSIAERAEFSSSLRLTETQVKIWFQNRRAKAKRLQEAELEKI 343

  Fly   227 RHQA 230
            :..|
Mosquito   344 KMAA 347

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11085NP_572815.3 Homeobox 163..216 CDD:278475 29/52 (56%)
AgaP_AGAP003669XP_313452.4 Homeobox 280..333 CDD:278475 30/55 (55%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000776
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.