DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11085 and AgaP_AGAP003406

DIOPT Version :9

Sequence 1:NP_572815.3 Gene:CG11085 / 32213 FlyBaseID:FBgn0030408 Length:295 Species:Drosophila melanogaster
Sequence 2:XP_311693.4 Gene:AgaP_AGAP003406 / 1272782 VectorBaseID:AGAP003406 Length:279 Species:Anopheles gambiae


Alignment Length:175 Identity:51/175 - (29%)
Similarity:68/175 - (38%) Gaps:38/175 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    69 SSVESCLSATRGPGSGTGSGGGGGGGGGGGVASGLSA-------------AAAAAGVAAGLLAAA 120
            ||..|..|:.|...|..|.|.....||......|..|             .....|..||.|..|
Mosquito    51 SSSSSSNSSPRSVHSEEGEGDDNDNGGRLRDEPGTEADEELDEEIDVGQSVMQHPGQEAGFLPTA 115

  Fly   121 ASGANGDRDANGGSGPGSGGGTSG-----GYAEHKL-QLSKSG---RKP-RRRRTAFTHAQLAYL 175
                           |..|..|..     .|...|| :..|:|   |.| |..|..||.|||:.|
Mosquito   116 ---------------PSCGMPTFDWLYYTRYHPPKLPRPQKTGPVKRTPGRLPRVPFTPAQLSAL 165

  Fly   176 ERKFRCQKYLSVADRSDVAETLNLSETQVKTWYQNRRTKWKRQNQ 220
            |..::...|||..:.:.:|.:|.|:.|:||.|:||||.:.:|:.:
Mosquito   166 EDAYKVSTYLSSEEANQLAYSLELTNTRVKIWFQNRRARDRREKR 210

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11085NP_572815.3 Homeobox 163..216 CDD:278475 22/52 (42%)
AgaP_AGAP003406XP_311693.4 Homeobox 153..200 CDD:278475 18/46 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000776
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.