DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11085 and AgaP_AGAP000063

DIOPT Version :9

Sequence 1:NP_572815.3 Gene:CG11085 / 32213 FlyBaseID:FBgn0030408 Length:295 Species:Drosophila melanogaster
Sequence 2:XP_566364.4 Gene:AgaP_AGAP000063 / 1272212 VectorBaseID:AGAP000063 Length:564 Species:Anopheles gambiae


Alignment Length:319 Identity:87/319 - (27%)
Similarity:122/319 - (38%) Gaps:99/319 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 INR--RQTDSELELS---------NDDSDIDIEDRSTPDSTAAGCQQELLLSHHHRRFTHHDESS 70
            |||  |...::.|.|         :||....::.:|..|::                |.|:... 
Mosquito   126 INRVLRNLAAQKEFSKKPHSADALSDDVGGYLQGKSLNDAS----------------FIHYKYG- 173

  Fly    71 VESCLSATRGPG--------SGTGSGGGG---GGGGGGGVASG-----------LSAAAAAAGVA 113
             :||.|......        |..|.||||   |||||||...|           :|........|
Mosquito   174 -DSCRSMQGAESVLRINDTYSRAGGGGGGPAAGGGGGGGAVPGGPGSESTDVKPMSDDGTKNPFA 237

  Fly   114 AGLLAAAASGANGDRDANGGSG-PGSGG-GTSGGYAEHKLQLSKSGRKPRRRRTAFTHAQLAYLE 176
            ........:|..|     .|:| ||.|| ||...:.::..:.....||.:|.||:||..|:.:||
Mosquito   238 KHCFTNLDAGVPG-----AGTGTPGQGGPGTKQVFVDNDTERLSLKRKLQRNRTSFTVDQIEFLE 297

  Fly   177 RKFRCQKYLSVADRSDVAETLNLSETQ-----VKTWYQNRRTKWKRQNQLRLEQLRHQATMEKDF 236
            ::|....|..|..|..::...||.|.:     ::.|:.|||.||:|:     |:.|.||..|   
Mosquito   298 KEFERTHYPDVFSRERLSSKTNLPEARIQVSYIEVWFSNRRAKWRRE-----EKQRSQAVSE--- 354

  Fly   237 VVQDGGGAGGLGCCPSGLSSSFSAAAAAAAAASNPCNFLTSAAAAAIFRNVGYVHGCPM 295
                               .|.||||||||||         |||||:......:..|.:
Mosquito   355 -------------------GSSSAAAAAAAAA---------AAAAAVAVQNASISSCSL 385

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11085NP_572815.3 Homeobox 163..216 CDD:278475 19/57 (33%)
AgaP_AGAP000063XP_566364.4 PAX 7..131 CDD:128645 3/4 (75%)
Homeobox 285..342 CDD:278475 19/56 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.