DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11085 and AgaP_AGAP000190

DIOPT Version :9

Sequence 1:NP_572815.3 Gene:CG11085 / 32213 FlyBaseID:FBgn0030408 Length:295 Species:Drosophila melanogaster
Sequence 2:XP_310944.5 Gene:AgaP_AGAP000190 / 1272074 VectorBaseID:AGAP000190 Length:493 Species:Anopheles gambiae


Alignment Length:286 Identity:58/286 - (20%)
Similarity:86/286 - (30%) Gaps:145/286 - (50%)


- Green bases have known domain annotations that are detailed below.


  Fly    74 CLSATRGPGSGTGSGGGGGGGGGG----------------------------------------G 98
            ||....|. :|||.|||||||.||                                        .
Mosquito    33 CLQDLVGV-NGTGGGGGGGGGAGGTGGGPGGANNTLADHLHGTGAHHGPHTHHSLHDGLVSGGVS 96

  Fly    99 VASGLSAAAAAAGVAAGLLAAAASGA----------------------------------NGD-- 127
            |:|.:::..:..|:.:|.|.....||                                  .||  
Mosquito    97 VSSAITSLMSPGGINSGGLGHLHHGAPDLSAHHHHHHHHHQHHHSSALHEPLEKLKLWAETGDFR 161

  Fly   128 ---------------------------------------------------------RDANGGSG 135
                                                                     .|..|...
Mosquito   162 ENSHTGMTSVSSIDHAQMGFPASSPRNRSSRDRKNDVSRCINEASVKTENLSSGMSHEDGTGSVA 226

  Fly   136 PGS---GGGTSGGYAEHKLQLSKSGRKPRRRRTAFTHAQLAYLERKFRCQKYLSVADRSDVAETL 197
            ||:   ..||.|      .:..|..::.||:||.||..||..||:.|...:|..::.|.::|...
Mosquito   227 PGTTIQQDGTDG------TKNDKKNKRQRRQRTHFTSQQLHELEQTFSRNRYPDMSTREEIAMWT 285

  Fly   198 NLSETQVKTWYQNRRTKWKR--QNQL 221
            ||:|.:|:.|::|||.||::  :||:
Mosquito   286 NLTEARVRVWFKNRRAKWRKRERNQM 311

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11085NP_572815.3 Homeobox 163..216 CDD:278475 21/52 (40%)
AgaP_AGAP000190XP_310944.5 Homeobox 252..304 CDD:278475 21/51 (41%)
OAR 445..460 CDD:281777
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.