DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11085 and AgaP_AGAP000484

DIOPT Version :9

Sequence 1:NP_572815.3 Gene:CG11085 / 32213 FlyBaseID:FBgn0030408 Length:295 Species:Drosophila melanogaster
Sequence 2:XP_310608.5 Gene:AgaP_AGAP000484 / 1271755 VectorBaseID:AGAP000484 Length:688 Species:Anopheles gambiae


Alignment Length:251 Identity:80/251 - (31%)
Similarity:108/251 - (43%) Gaps:68/251 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 RRQTDSELELSNDDSDIDIEDRSTPDSTAAGCQQELLLS--------HHHRRFTHHDES------ 69
            |..|..||       .:|..:.|:.|. .:||..:|..|        .|..|.|..:.:      
Mosquito   400 RSDTSEEL-------IVDGNEESSQDG-ISGCPVDLTRSMDNGSDTKPHAIRDTDKEAASKRLAF 456

  Fly    70 SVESCLSATRGPGSGTGSGGGGGGGGGGGVASGL---------SAAAAAAGVAAGLLAAAASGA- 124
            |||:.|...:..|....:.||||||....::.|:         ....|..|.|.|..|...:.. 
Mosquito   457 SVENILDPNKFNGKQHCASGGGGGGAVTPISGGIFGPKLNGTKRGGPALNGAAGGNYATNNNNCT 521

  Fly   125 -------------NGDRDAN-------------GGSGPGSGGGTSGGYAEHKLQLSKSGRKPRRR 163
                         |.:.:||             .||...||.|.|.|          :..||||.
Mosquito   522 VNNNNNNNNNNSINHNNNANDMDDHASETDSKKDGSTNRSGDGKSQG----------NSSKPRRA 576

  Fly   164 RTAFTHAQLAYLERKFRCQKYLSVADRSDVAETLNLSETQVKTWYQNRRTKWKRQN 219
            |||||:.||..||.||:..:||||.:|.::|.:|:|:|||||.|:||||||||:||
Mosquito   577 RTAFTYEQLVSLENKFKTTRYLSVCERLNLALSLSLTETQVKIWFQNRRTKWKKQN 632

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11085NP_572815.3 Homeobox 163..216 CDD:278475 31/52 (60%)
AgaP_AGAP000484XP_310608.5 COG5576 <565..675 CDD:227863 41/78 (53%)
Homeobox 577..629 CDD:278475 31/51 (61%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0488
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.