DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11085 and AgaP_AGAP006923

DIOPT Version :9

Sequence 1:NP_572815.3 Gene:CG11085 / 32213 FlyBaseID:FBgn0030408 Length:295 Species:Drosophila melanogaster
Sequence 2:XP_308835.4 Gene:AgaP_AGAP006923 / 1270160 VectorBaseID:AGAP006923 Length:580 Species:Anopheles gambiae


Alignment Length:198 Identity:67/198 - (33%)
Similarity:83/198 - (41%) Gaps:49/198 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    65 HHDESSVESCLSATRGPGSGTGSGG-------------GGGGGGGGGVASGLSAAAAAAGVAAGL 116
            ||...|.    ..|..|||   .||             ||....|...:..:|...:.:|.....
Mosquito   262 HHQPQSP----GETIDPGS---DGGPEDEERTRPTIEDGGESADGSAYSDDISLTLSPSGCGKTT 319

  Fly   117 -LAAAASGANGDRDANGGSGPGSGGGTSGGYAEHKLQLSKSGRKPRRRRTAFTHAQLAYLERKFR 180
             |..:.|.|..:.|....|......|.||..||:.        |.||||||||..||..|||:|.
Mosquito   320 DLGDSDSDACSEDDCTQNSSSSGRAGKSGSGAENS--------KSRRRRTAFTSEQLLELEREFH 376

  Fly   181 CQKYLSVADRSDVAETLNLSETQVKTWYQNRRTKWKRQNQLRLEQLRHQATMEKDFVVQDGGGAG 245
            .:||||:.:||.:|.:|.|||.|||.|:||||.||||                    |:.|..:.
Mosquito   377 AKKYLSLTERSQIATSLKLSEVQVKIWFQNRRAKWKR--------------------VKAGLNSH 421

  Fly   246 GLG 248
            |||
Mosquito   422 GLG 424

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11085NP_572815.3 Homeobox 163..216 CDD:278475 32/52 (62%)
AgaP_AGAP006923XP_308835.4 Homeobox 359..412 CDD:278475 32/52 (62%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.