DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11085 and AgaP_AGAP007058

DIOPT Version :9

Sequence 1:NP_572815.3 Gene:CG11085 / 32213 FlyBaseID:FBgn0030408 Length:295 Species:Drosophila melanogaster
Sequence 2:XP_308706.3 Gene:AgaP_AGAP007058 / 1270045 VectorBaseID:AGAP007058 Length:302 Species:Anopheles gambiae


Alignment Length:203 Identity:58/203 - (28%)
Similarity:93/203 - (45%) Gaps:41/203 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    95 GGGGVASGLSAAAAAAGVAAGLLAAAASGANG----DRDANGGSG--------PGSGGGTSGGY- 146
            |.||:.||....:|..|..:|.  .:..||.|    ....|..||        |.:.....|.| 
Mosquito    34 GYGGIRSGYQHFSAQGGQDSGF--PSPRGALGYPFPPMHQNSYSGYHLGSYAPPCASPPKDGKYK 96

  Fly   147 -AEHKLQLSKSGRKPRRRRTAFTHAQLAYLERKFRCQKYLSVADRSDVAETLNLSETQVKTWYQN 210
             .:..|:::..|:|.|:.||.::..||..|.|:|:..:||::.:|:::|.:|.|::||||.|:||
Mosquito    97 LEDTGLRVNGKGKKMRKPRTIYSSLQLQQLNRRFQRTQYLALPERAELAASLGLTQTQVKIWFQN 161

  Fly   211 RRTKWKRQNQLRLEQLRHQATMEKDFVVQDGGGAGGL--------GCCPSGLSSSFSAAAAAAAA 267
            ||:|:|:..:                ..|..|..|||        |..||...:...|....:::
Mosquito   162 RRSKYKKMMK----------------AAQAPGVGGGLPLGGPNQGGHSPSQHQNMHQAPGGGSSS 210

  Fly   268 ASNPCNFL 275
            .| |.:||
Mosquito   211 GS-PSHFL 217

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11085NP_572815.3 Homeobox 163..216 CDD:278475 23/52 (44%)
AgaP_AGAP007058XP_308706.3 Homeobox 114..167 CDD:278475 23/52 (44%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.