DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11085 and Barx1

DIOPT Version :9

Sequence 1:NP_572815.3 Gene:CG11085 / 32213 FlyBaseID:FBgn0030408 Length:295 Species:Drosophila melanogaster
Sequence 2:NP_031552.2 Gene:Barx1 / 12022 MGIID:103124 Length:254 Species:Mus musculus


Alignment Length:238 Identity:76/238 - (31%)
Similarity:92/238 - (38%) Gaps:91/238 - (38%)


- Green bases have known domain annotations that are detailed below.


  Fly    49 GCQQELLLSHHHRRFTHHDESSVESCLSATRGPGSGTGSGGGGGGGGGGGVASGLSAAAAAAGVA 113
            ||...  ..|.:|.|      .:|..|:...||                     ..||.|||..|
Mouse    17 GCADH--RPHRYRSF------MIEEILTEPPGP---------------------KGAAPAAAAAA 52

  Fly   114 AG---------LLAA----------------------AASGANGDRDANGGSGPGSGGGTSGGYA 147
            ||         ||||                      |..|.:|...|...:|||..|.....:.
Mouse    53 AGELLKFGVQALLAARPFHSHLAVLKAEQAAVFKFPLAPLGCSGLGSALLAAGPGMPGPAGASHL 117

  Fly   148 EHKLQL------SKSG------RKPRRRRTAFTHAQLAYLERKFRCQKYLSVADRSDVAETLNLS 200
            ..:|||      :.||      :|.||.||.||..||..||::|..|||||..||.|:||:|.||
Mouse   118 PLELQLRGKLEAAGSGEPGAKAKKGRRSRTVFTELQLMGLEKRFEKQKYLSTPDRIDLAESLGLS 182

  Fly   201 ETQVKTWYQNRRTKWKRQNQLRLEQLRHQATMEKDFVVQDGGG 243
            :.||||||||||.|||:                   :|..|||
Mouse   183 QLQVKTWYQNRRMKWKK-------------------IVLQGGG 206

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11085NP_572815.3 Homeobox 163..216 CDD:278475 33/52 (63%)
Barx1NP_031552.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..20 2/2 (100%)
Homeobox 145..198 CDD:278475 33/52 (63%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 204..254 3/3 (100%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0488
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.