DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11085 and Alx3

DIOPT Version :9

Sequence 1:NP_572815.3 Gene:CG11085 / 32213 FlyBaseID:FBgn0030408 Length:295 Species:Drosophila melanogaster
Sequence 2:NP_031467.1 Gene:Alx3 / 11694 MGIID:1277097 Length:343 Species:Mus musculus


Alignment Length:232 Identity:64/232 - (27%)
Similarity:96/232 - (41%) Gaps:29/232 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    89 GGGGGGGGGGVASGLSAAAAAAGVAAGLLAAAASGANGDRD--ANGGSGPGS-----GGGTSGGY 146
            |.|....||....|.:.|...|..||...........|.||  :|..:.||.     ....|.|.
Mouse    76 GPGPVLNGGHFYEGSAEAEEKASKAASFPQLPVDCRGGPRDGPSNVQASPGPCLASLSVPLSPGL 140

  Fly   147 AEHKLQLSKSGRKPRRRRTAFTHAQLAYLERKFRCQKYLSVADRSDVAETLNLSETQVKTWYQNR 211
            .: .::|:|:..|.||.||.|:..||..||:.|:...|..|..|..:|...:|:|.:|:.|:|||
Mouse   141 PD-SMELAKTKSKKRRNRTTFSTFQLEELEKVFQKTHYPDVYAREQLALRTDLTEARVQVWFQNR 204

  Fly   212 RTKW-KRQNQLRLEQLRHQATMEKDFVV----------------QDGGGAGGLGC--CPSGLSSS 257
            |.|| ||:...::::.|:..|...|..|                ..|.|:.|..|  .|.|:.| 
Mouse   205 RAKWRKRERYGKMQEGRNPFTTAYDISVLPRTDSHPQLQNSLWPSPGSGSPGGPCLMSPEGIPS- 268

  Fly   258 FSAAAAAAAAASNPCNFLTSAAAAAIFRNVGYVHGCP 294
             ...:..:.:..|...|:...|:.|....:..:||.|
Mouse   269 -PCMSPYSHSHGNVAGFMGVPASPAAHPGIYSIHGFP 304

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11085NP_572815.3 Homeobox 163..216 CDD:278475 22/53 (42%)
Alx3NP_031467.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..122 13/45 (29%)
SP2 32..>141 CDD:281067 17/64 (27%)
Homeobox 157..209 CDD:278475 21/51 (41%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 309..343
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.