DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11085 and ATHB54

DIOPT Version :10

Sequence 1:NP_572815.3 Gene:CG11085 / 32213 FlyBaseID:FBgn0030408 Length:295 Species:Drosophila melanogaster
Sequence 2:NP_001322131.1 Gene:ATHB54 / 10723019 AraportID:AT1G27045 Length:252 Species:Arabidopsis thaliana


Alignment Length:66 Identity:23/66 - (34%)
Similarity:33/66 - (50%) Gaps:6/66 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly   163 RRTAFTHAQLAYLERKFRCQKYLSVADRSDVAETLNLSETQVKTWYQNRRTKWKRQNQLRLEQLR 227
            ::...|..||..||..|..:|.|....:..:||.|.|..:||..|:||||.::|      .:||.
plant    68 KKRKLTPIQLRLLEESFEEEKRLEPDRKLWLAEKLGLQPSQVAVWFQNRRARYK------TKQLE 126

  Fly   228 H 228
            |
plant   127 H 127

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11085NP_572815.3 Homeodomain 161..217 CDD:459649 19/53 (36%)
ATHB54NP_001322131.1 HOX 68..121 CDD:197696 19/52 (37%)
HALZ 123..161 CDD:460477 3/5 (60%)

Return to query results.
Submit another query.