Sequence 1: | NP_572815.3 | Gene: | CG11085 / 32213 | FlyBaseID: | FBgn0030408 | Length: | 295 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_006553.2 | Gene: | LBX1 / 10660 | HGNCID: | 16960 | Length: | 281 | Species: | Homo sapiens |
Alignment Length: | 227 | Identity: | 67/227 - (29%) |
---|---|---|---|
Similarity: | 88/227 - (38%) | Gaps: | 74/227 - (32%) |
- Green bases have known domain annotations that are detailed below.
Fly 113 AAGLLAAAASGANGDRDANGG-----------------------------------SGPGSGGGT 142
Fly 143 SGGYAEHKLQLSKSGRKPRRRRTAFTHAQLAYLERKFRCQKYLSVADRSDVAETLNLSETQVKTW 207
Fly 208 YQNRRTKWKRQNQLRLEQLRHQATMEK--------DFVV---------QDGGGAGGLGCCPSG-- 253
Fly 254 ---LSSSFSAAAAAAAAASNPCNFLTSAAAAA 282 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG11085 | NP_572815.3 | Homeobox | 163..216 | CDD:278475 | 29/52 (56%) |
LBX1 | NP_006553.2 | Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 1..35 | ||
Homeobox | 128..181 | CDD:278475 | 29/52 (56%) | ||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 214..281 | 14/52 (27%) | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_KOG0488 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.900 |