DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11085 and LBX1

DIOPT Version :9

Sequence 1:NP_572815.3 Gene:CG11085 / 32213 FlyBaseID:FBgn0030408 Length:295 Species:Drosophila melanogaster
Sequence 2:NP_006553.2 Gene:LBX1 / 10660 HGNCID:16960 Length:281 Species:Homo sapiens


Alignment Length:227 Identity:67/227 - (29%)
Similarity:88/227 - (38%) Gaps:74/227 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly   113 AAGLLAAAASGANGDRDANGG-----------------------------------SGPGSGGGT 142
            ||.|||||      |:.|.||                                   :..|..|.|
Human    56 AAHLLAAA------DKHAQGGLPLAGRALLSQTSPLCALEELASKTFKGLEVSVLQAAEGRDGMT 114

  Fly   143 SGGYAEHKLQLSKSGRKPRRRRTAFTHAQLAYLERKFRCQKYLSVADRSDVAETLNLSETQVKTW 207
            ..|..:       :.:|.|:.|||||:.|:..||::|..|||||.|||..:|:.|.|:..||.||
Human   115 IFGQRQ-------TPKKRRKSRTAFTNHQIYELEKRFLYQKYLSPADRDQIAQQLGLTNAQVITW 172

  Fly   208 YQNRRTKWKRQNQLRLEQLRHQATMEK--------DFVV---------QDGGGAGGLGCCPSG-- 253
            :||||.|.||.    ||:::......|        |.|.         ...||.||.|...|.  
Human   173 FQNRRAKLKRD----LEEMKADVESAKKLGPSGQMDIVALAELEQNSEATAGGGGGCGRAKSRPG 233

  Fly   254 ---LSSSFSAAAAAAAAASNPCNFLTSAAAAA 282
               |......|..|.|...:|.:.||...|::
Human   234 SPVLPPGAPKAPGAGALQLSPASPLTDQPASS 265

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11085NP_572815.3 Homeobox 163..216 CDD:278475 29/52 (56%)
LBX1NP_006553.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..35
Homeobox 128..181 CDD:278475 29/52 (56%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 214..281 14/52 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0488
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.