DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11085 and CDX2

DIOPT Version :9

Sequence 1:NP_572815.3 Gene:CG11085 / 32213 FlyBaseID:FBgn0030408 Length:295 Species:Drosophila melanogaster
Sequence 2:XP_011533177.1 Gene:CDX2 / 1045 HGNCID:1806 Length:321 Species:Homo sapiens


Alignment Length:215 Identity:58/215 - (26%)
Similarity:86/215 - (40%) Gaps:66/215 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    75 LSATRGPGSG-------------TGSGGGGGGGGGGGVASGLS--AAAAAAGVAAGL-------- 116
            |.:.:.||..             .|...||.......||.||:  :.|||.|.::..        
Human    55 LDSAQSPGPSWPAAYGAPLREDWNGYAPGGAAAAANAVAHGLNGGSPAAAMGYSSPADYHPHHHP 119

  Fly   117 ------LAAAASGANGDRDANGGSGPGSGGGTSGGYAEHKLQLSKSG---------RKPRRR--- 163
                  .|||.|.|:|....   ..||..|..:...||   |||..|         |||.::   
Human   120 HHHPHHPAAAPSCASGLLQT---LNPGPPGPAATAAAE---QLSPGGQRRNLCEWMRKPAQQSLG 178

  Fly   164 -------------------RTAFTHAQLAYLERKFRCQKYLSVADRSDVAETLNLSETQVKTWYQ 209
                               |..:|..|...||::|...:|:::..::::|.||.|||.|||.|:|
Human   179 SQALTSPSSTVKTRTKDKYRVVYTDHQRLELEKEFHYSRYITIRRKAELAATLGLSERQVKIWFQ 243

  Fly   210 NRRTKWKRQNQLRLEQLRHQ 229
            |||.|.::.|:.:|:|.:.|
Human   244 NRRAKERKINKKKLQQQQQQ 263

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11085NP_572815.3 Homeobox 163..216 CDD:278475 22/74 (30%)
CDX2XP_011533177.1 Caudal_act 13..171 CDD:282574 29/121 (24%)
Homeobox 198..250 CDD:278475 22/51 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.