DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11085 and CDX1

DIOPT Version :9

Sequence 1:NP_572815.3 Gene:CG11085 / 32213 FlyBaseID:FBgn0030408 Length:295 Species:Drosophila melanogaster
Sequence 2:NP_001795.2 Gene:CDX1 / 1044 HGNCID:1805 Length:265 Species:Homo sapiens


Alignment Length:196 Identity:56/196 - (28%)
Similarity:80/196 - (40%) Gaps:35/196 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    76 SATRGPGSGTGSGGGGGGGGGGGVASG----LSAAAAAAGVAAGLLAAAASGANGDRDANGGSGP 136
            :|..|||....:      .....:|.|    .|...|..|...||||....|. |...:.|...|
Human    73 AAAYGPGPAAPA------ASPASLAFGPPPDFSPVPAPPGPGPGLLAQPLGGP-GTPSSPGAQRP 130

  Fly   137 -----------GSGGGTSGGYAEHKLQLSKSGRKPRRRRTAFTHAQLAYLERKFRCQKYLSVADR 190
                       ..|||.||           ..|...:.|..:|..|...||::|...:|:::..:
Human   131 TPYEWMRRSVAAGGGGGSG-----------KTRTKDKYRVVYTDHQRLELEKEFHYSRYITIRRK 184

  Fly   191 SDVAETLNLSETQVKTWYQNRRTKWKRQNQLRLEQLR-HQATMEKDFVVQDGGGAGGLGCCPSGL 254
            |::|..|.|:|.|||.|:||||.|.::.|:.:.:|.: .|..|..|......|.:.| |.|||..
Human   185 SELAANLGLTERQVKIWFQNRRAKERKVNKKKQQQQQPPQPPMAHDITATPAGPSLG-GLCPSNT 248

  Fly   255 S 255
            |
Human   249 S 249

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11085NP_572815.3 Homeobox 163..216 CDD:278475 21/52 (40%)
CDX1NP_001795.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 9..153 22/97 (23%)
Caudal_act 13..138 CDD:282574 17/71 (24%)
Interaction with DNA. /evidence=ECO:0000305|PubMed:28473536 157..178 6/20 (30%)
Homeobox 158..210 CDD:278475 21/51 (41%)
Interaction with 5-mCpG DNA. /evidence=ECO:0000305|PubMed:28473536 196..207 7/10 (70%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 207..265 13/44 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.