Sequence 1: | NP_572815.3 | Gene: | CG11085 / 32213 | FlyBaseID: | FBgn0030408 | Length: | 295 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001795.2 | Gene: | CDX1 / 1044 | HGNCID: | 1805 | Length: | 265 | Species: | Homo sapiens |
Alignment Length: | 196 | Identity: | 56/196 - (28%) |
---|---|---|---|
Similarity: | 80/196 - (40%) | Gaps: | 35/196 - (17%) |
- Green bases have known domain annotations that are detailed below.
Fly 76 SATRGPGSGTGSGGGGGGGGGGGVASG----LSAAAAAAGVAAGLLAAAASGANGDRDANGGSGP 136
Fly 137 -----------GSGGGTSGGYAEHKLQLSKSGRKPRRRRTAFTHAQLAYLERKFRCQKYLSVADR 190
Fly 191 SDVAETLNLSETQVKTWYQNRRTKWKRQNQLRLEQLR-HQATMEKDFVVQDGGGAGGLGCCPSGL 254
Fly 255 S 255 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG11085 | NP_572815.3 | Homeobox | 163..216 | CDD:278475 | 21/52 (40%) |
CDX1 | NP_001795.2 | Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 9..153 | 22/97 (23%) | |
Caudal_act | 13..138 | CDD:282574 | 17/71 (24%) | ||
Interaction with DNA. /evidence=ECO:0000305|PubMed:28473536 | 157..178 | 6/20 (30%) | |||
Homeobox | 158..210 | CDD:278475 | 21/51 (41%) | ||
Interaction with 5-mCpG DNA. /evidence=ECO:0000305|PubMed:28473536 | 196..207 | 7/10 (70%) | |||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 207..265 | 13/44 (30%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.910 |