DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11085 and Barhl2

DIOPT Version :9

Sequence 1:NP_572815.3 Gene:CG11085 / 32213 FlyBaseID:FBgn0030408 Length:295 Species:Drosophila melanogaster
Sequence 2:NP_001005477.1 Gene:Barhl2 / 104382 MGIID:1859314 Length:384 Species:Mus musculus


Alignment Length:300 Identity:87/300 - (28%)
Similarity:106/300 - (35%) Gaps:113/300 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 SSKSFLIRDLLGDLINRRQTDSELELSNDDSDIDIEDRSTPDSTAAGCQQELLLSHH-------- 59
            |:.||||:|:|||                         |.|.:..|.....:...||        
Mouse   135 STSSFLIKDILGD-------------------------SKPLAACAPYSTSVSSPHHTPKQESNA 174

  Fly    60 -HRRFTHH-DESSVESCLSATRGPGSGTGSGGGGGGGGGGGVASGLSAAAAAAGVAAGLLAAAAS 122
             |..|... ::...::.|.....|.|.....|                                :
Mouse   175 AHESFRPKLEQEDGKTKLDKREDPQSDIKCHG--------------------------------T 207

  Fly   123 GANGDRDANGG--SGPGSGGGTSGGYAEHKLQLSKSGRKPRRRRTAFTHAQLAYLERKFRCQKYL 185
            ...|||:....  |.|                  ...:|||:.||||:..||..|||.|..||||
Mouse   208 KEEGDREITSSRESPP------------------VRAKKPRKARTAFSDHQLNQLERSFERQKYL 254

  Fly   186 SVADRSDVAETLNLSETQVKTWYQNRRTKWKRQNQLRLEQLRHQATMEKDFVVQDGGGAGGLGCC 250
            ||.||.|:|..|||::|||||||||||||||||..:.||.|..               ||.....
Mouse   255 SVQDRMDLAAALNLTDTQVKTWYQNRRTKWKRQTAVGLELLAE---------------AGNYSAL 304

  Fly   251 -----------PSGLSSSFSAAAAAAAAASNPCNFLTSAA 279
                       ||.|.|..|..|||||||.....:.|..|
Mouse   305 QRMFPSPYFYHPSLLGSMDSTTAAAAAAAMYSSMYRTPPA 344

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11085NP_572815.3 Homeobox 163..216 CDD:278475 36/52 (69%)
Barhl2NP_001005477.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..134
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 154..235 18/130 (14%)
Homeobox 233..285 CDD:278475 36/51 (71%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 364..384
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0488
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X1387
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
54.770

Return to query results.
Submit another query.