powered by:
Protein Alignment CG11085 and tmem143
DIOPT Version :9
Sequence 1: | NP_572815.3 |
Gene: | CG11085 / 32213 |
FlyBaseID: | FBgn0030408 |
Length: | 295 |
Species: | Drosophila melanogaster |
Sequence 2: | XP_031762409.1 |
Gene: | tmem143 / 100496619 |
XenbaseID: | XB-GENE-6044161 |
Length: | 507 |
Species: | Xenopus tropicalis |
Alignment Length: | 44 |
Identity: | 14/44 - (31%) |
Similarity: | 19/44 - (43%) |
Gaps: | 14/44 - (31%) |
- Green bases have known domain annotations that are detailed below.
Fly 11 DLLGDLINRRQTD------------SELELSNDDSDIDIEDRST 42
:|||.||.|.|.: .:|.|.:|.| :.||..|
Frog 423 ELLGALILRAQEEHAKEVILAHSFLKQLNLPSDGS--EAEDPKT 464
|
Known Domains:
Indicated by green bases in alignment.
Gene | Sequence | Domain | Region |
External ID | Identity |
CG11085 | NP_572815.3 |
Homeobox |
163..216 |
CDD:278475 |
|
tmem143 | XP_031762409.1 |
DUF3754 |
298..422 |
CDD:403691 |
|
Blue background indicates that the domain is not in
the aligned region.
|
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
1 |
0.910 |
- |
- |
|
|
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.910 |
|
Return to query results.
Submit another query.