DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11085 and dbx1

DIOPT Version :9

Sequence 1:NP_572815.3 Gene:CG11085 / 32213 FlyBaseID:FBgn0030408 Length:295 Species:Drosophila melanogaster
Sequence 2:XP_002940015.1 Gene:dbx1 / 100495433 XenbaseID:XB-GENE-480177 Length:328 Species:Xenopus tropicalis


Alignment Length:68 Identity:31/68 - (45%)
Similarity:41/68 - (60%) Gaps:3/68 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly   159 KPRR---RRTAFTHAQLAYLERKFRCQKYLSVADRSDVAETLNLSETQVKTWYQNRRTKWKRQNQ 220
            ||||   ||..|:..|...||:.|:.|||:|..||..:|..|.|.::|||.|:||||.||:...:
 Frog   168 KPRRGMLRRAVFSDVQRKALEKMFQKQKYISKPDRKKLAGKLGLKDSQVKIWFQNRRMKWRNSKE 232

  Fly   221 LRL 223
            ..|
 Frog   233 REL 235

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11085NP_572815.3 Homeobox 163..216 CDD:278475 25/52 (48%)
dbx1XP_002940015.1 Homeobox 175..229 CDD:365835 26/53 (49%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.