powered by:
Protein Alignment CG11085 and dbx1
DIOPT Version :9
Sequence 1: | NP_572815.3 |
Gene: | CG11085 / 32213 |
FlyBaseID: | FBgn0030408 |
Length: | 295 |
Species: | Drosophila melanogaster |
Sequence 2: | XP_002940015.1 |
Gene: | dbx1 / 100495433 |
XenbaseID: | XB-GENE-480177 |
Length: | 328 |
Species: | Xenopus tropicalis |
Alignment Length: | 68 |
Identity: | 31/68 - (45%) |
Similarity: | 41/68 - (60%) |
Gaps: | 3/68 - (4%) |
- Green bases have known domain annotations that are detailed below.
Fly 159 KPRR---RRTAFTHAQLAYLERKFRCQKYLSVADRSDVAETLNLSETQVKTWYQNRRTKWKRQNQ 220
|||| ||..|:..|...||:.|:.|||:|..||..:|..|.|.::|||.|:||||.||:...:
Frog 168 KPRRGMLRRAVFSDVQRKALEKMFQKQKYISKPDRKKLAGKLGLKDSQVKIWFQNRRMKWRNSKE 232
Fly 221 LRL 223
..|
Frog 233 REL 235
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
1 |
0.910 |
- |
- |
|
|
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.910 |
|
Return to query results.
Submit another query.