DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11085 and nobox

DIOPT Version :9

Sequence 1:NP_572815.3 Gene:CG11085 / 32213 FlyBaseID:FBgn0030408 Length:295 Species:Drosophila melanogaster
Sequence 2:XP_031761569.1 Gene:nobox / 100494031 XenbaseID:XB-GENE-22068768 Length:652 Species:Xenopus tropicalis


Alignment Length:393 Identity:75/393 - (19%)
Similarity:118/393 - (30%) Gaps:156/393 - (39%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 TDSELELSND---DSDIDIEDR-STPDSTAA------GCQQELLLSHHHRRFTHHDESSVESCLS 76
            |.:.|.:.:|   |||..::.. |:.||::.      .|:                 |.:.|...
 Frog    17 TGNALRVGSDPLPDSDGSLQSLVSSADSSSTLIAPIRPCR-----------------SRLTSTCG 64

  Fly    77 ATRGPGSGTGSGG--------------------------------------GGGG---------- 93
            |..||....|..|                                      .|||          
 Frog    65 AANGPAGNRGETGPAQAEKWIRNRRQREDEKRCQLGSPDEEETSLRCLEPEAGGGPQDEYRAVLI 129

  Fly    94 --GGGGGVAS-----GLSAAAAAAG----------VAAGLLAAAASGA----NGDRDANGGSGPG 137
              ||.|.|||     |::.:...|.          ...|.|..|..|.    :||.....|..|.
 Frog   130 NEGGNGLVASDPREFGINPSGGCASEGGQCQLSLLAVCGPLPEATGGCYSAFSGDDPQGPGYFPP 194

  Fly   138 SGG------GTSGGYAE------HKLQLSKSGRKP------------------------------ 160
            .|.      ...|.:.:      ...:.:.|.|.|                              
 Frog   195 RGQFQPVNLKVEGNFPQSAPLPRRSARCAASCRLPTFIYDTGHGGDRQRGKCPADAPEEPGPPCR 259

  Fly   161 RRRRTAFTHAQLAYLERKFRCQKYLSVADRSDVAETLNLSETQVKTWYQNRRTKWKRQNQLRLEQ 225
            ::.||.::..||..|||.|....|.....|.::||.:.::..::..|:||||.||::..:..::.
 Frog   260 KKSRTLYSMDQLQELERLFAEDHYPDSEKRREIAEIIGVTPQRIMVWFQNRRAKWRKVEKTSIKG 324

  Fly   226 LRHQATMEKDFVVQDGGGAGGLGCCPSG---LSSSFSAAAAAAAAASNPCNFLTSAAAAAIFRNV 287
            .|...:            |.|:....:.   :|||.:.:...|.:.|....|.|..:|   |..|
 Frog   325 PRKPLS------------AAGMSRPETAVLTVSSSVALSRPEAVSLSVTSGFHTYGSA---FPPV 374

  Fly   288 GYV 290
            |.|
 Frog   375 GGV 377

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11085NP_572815.3 Homeobox 163..216 CDD:278475 18/52 (35%)
noboxXP_031761569.1 COG5576 <252..364 CDD:227863 27/123 (22%)
Homeobox 262..316 CDD:395001 19/53 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.