DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11085 and barhl2

DIOPT Version :9

Sequence 1:NP_572815.3 Gene:CG11085 / 32213 FlyBaseID:FBgn0030408 Length:295 Species:Drosophila melanogaster
Sequence 2:XP_012817899.1 Gene:barhl2 / 100493839 XenbaseID:XB-GENE-482777 Length:359 Species:Xenopus tropicalis


Alignment Length:293 Identity:91/293 - (31%)
Similarity:108/293 - (36%) Gaps:96/293 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 SSKSFLIRDLLGDLINRRQTDSELELSNDDSDIDIEDRSTPDSTAAGCQQELLLSHHHRRFTHHD 67
            |:.||||:|:|||                         |.|.:..|.....:...||..:  |..
 Frog   107 STSSFLIKDILGD-------------------------SKPLAACAPYSTTVPSPHHTPK--HEG 144

  Fly    68 ESSVESC---LSATRGPGSGTGSGGGGGGGGGGGVASGLSAAAAAAGVAAGLLAAAASGANGDRD 129
            ..|.||.   |......|.|...          .:...|.......|          :...|||:
 Frog   145 NGSSESFRPKLEQEMQDGKGKAE----------KIREDLHTDIKGHG----------TKEEGDRE 189

  Fly   130 ANGG--SGPGSGGGTSGGYAEHKLQLSKSGRKPRRRRTAFTHAQLAYLERKFRCQKYLSVADRSD 192
            ....  |.|                  ...:|||:.||||:..||..|||.|..||||||.||.|
 Frog   190 ITSSRESPP------------------VRAKKPRKARTAFSDHQLNQLERSFERQKYLSVQDRMD 236

  Fly   193 VAETLNLSETQVKTWYQNRRTKWKRQNQLRLEQLRHQATMEKDFVVQDGGGAGGLGCC------- 250
            :|..|||::|||||||||||||||||..:.||.|..               ||.....       
 Frog   237 LAAALNLTDTQVKTWYQNRRTKWKRQTAVGLELLAE---------------AGNYSALQRMFPSP 286

  Fly   251 ----PSGLSSSFSAAAAAAAAASNPCNFLTSAA 279
                ||.|||..|..|||||||.....:.|..|
 Frog   287 YFYHPSLLSSMDSTTAAAAAAAMYSSMYRTPPA 319

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11085NP_572815.3 Homeobox 163..216 CDD:278475 36/52 (69%)
barhl2XP_012817899.1 Homeobox 208..261 CDD:365835 37/52 (71%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X1387
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.