DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment CG11085 and hoxc13

DIOPT Version :9

Sequence 1:	NP_572815.3	Gene:	CG11085 / 32213	FlyBaseID:	FBgn0030408	Length:	295	Species:	Drosophila melanogaster
Sequence 2:	XP_002936691.1	Gene:	hoxc13 / 100487255	XenbaseID:	XB-GENE-478832	Length:	306	Species:	Xenopus tropicalis

Alignment Length:	60	Identity:	22/60 - (36%)
Similarity:	37/60 - (61%)	Gaps:	0/60 - (0%)

- Green bases have known domain annotations that are detailed below.

  Fly   158 RKPRRRRTAFTHAQLAYLERKFRCQKYLSVADRSDVAETLNLSETQVKTWYQNRRTKWKR 217
            |:.|::|..:|..||..||:::...|:::...|..::...:|||.||..|:||||.|.|:
Frog   234 RRGRKKRVPYTKIQLKELEKEYAASKFITKEKRRRISTATSLSERQVTIWFQNRRVKEKK 293

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
CG11085	NP_572815.3	Homeobox	163..216	CDD:278475	19/52 (37%)
hoxc13	XP_002936691.1	HoxA13_N	31..142	CDD:372013
hoxc13	XP_002936691.1	Homeobox	239..293	CDD:365835	19/53 (36%)
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	1	0.910	-	-
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
	1	0.910