DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11085 and hoxc13

DIOPT Version :10

Sequence 1:NP_572815.3 Gene:CG11085 / 32213 FlyBaseID:FBgn0030408 Length:295 Species:Drosophila melanogaster
Sequence 2:XP_002936691.1 Gene:hoxc13 / 100487255 XenbaseID:XB-GENE-478832 Length:306 Species:Xenopus tropicalis


Alignment Length:60 Identity:22/60 - (36%)
Similarity:37/60 - (61%) Gaps:0/60 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly   158 RKPRRRRTAFTHAQLAYLERKFRCQKYLSVADRSDVAETLNLSETQVKTWYQNRRTKWKR 217
            |:.|::|..:|..||..||:::...|:::...|..::...:|||.||..|:||||.|.|:
 Frog   234 RRGRKKRVPYTKIQLKELEKEYAASKFITKEKRRRISTATSLSERQVTIWFQNRRVKEKK 293

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11085NP_572815.3 Homeodomain 161..217 CDD:459649 20/55 (36%)
hoxc13XP_002936691.1 HoxA13_N 31..144 CDD:463521
Homeodomain 237..293 CDD:459649 20/55 (36%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.