DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11085 and hmx2

DIOPT Version :9

Sequence 1:NP_572815.3 Gene:CG11085 / 32213 FlyBaseID:FBgn0030408 Length:295 Species:Drosophila melanogaster
Sequence 2:XP_002937849.1 Gene:hmx2 / 100486800 XenbaseID:XB-GENE-480085 Length:252 Species:Xenopus tropicalis


Alignment Length:99 Identity:39/99 - (39%)
Similarity:54/99 - (54%) Gaps:20/99 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   126 GDRDANGGSGPGSGGGTSGGYAEHKLQLSKSGRKPRRRRTAFTHAQLAYLERKFRCQKYLSVADR 190
            |||..:||                    .|.|...::.||.|:.:|:..||..|..::|||.::|
 Frog   115 GDRHKDGG--------------------DKMGNSKKKTRTVFSRSQVYQLESTFDMKRYLSSSER 159

  Fly   191 SDVAETLNLSETQVKTWYQNRRTKWKRQNQLRLE 224
            :.:|.:|.|:|||||||:||||.|||||....||
 Frog   160 ACLASSLQLTETQVKTWFQNRRNKWKRQLSAELE 193

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11085NP_572815.3 Homeobox 163..216 CDD:278475 26/52 (50%)
hmx2XP_002937849.1 Homeobox 132..186 CDD:365835 27/53 (51%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.