DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11085 and arx

DIOPT Version :9

Sequence 1:NP_572815.3 Gene:CG11085 / 32213 FlyBaseID:FBgn0030408 Length:295 Species:Drosophila melanogaster
Sequence 2:XP_002933659.1 Gene:arx / 100486727 XenbaseID:XB-GENE-483940 Length:536 Species:Xenopus tropicalis


Alignment Length:330 Identity:80/330 - (24%)
Similarity:120/330 - (36%) Gaps:109/330 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 IRDLLGDLINRRQTDSELELSNDDSDIDIEDRSTPDSTAAGCQQELLLSHH----------HRRF 63
            ::|.||.|       |:.....||.|.:.||....:..    :.|....|:          |.:.
 Frog   183 LQDRLGAL-------SQSPRDEDDDDEEDEDEEEEEEE----EDEANKQHNPNNSSNPNRAHLQE 236

  Fly    64 THHDESSVESCLSATRGPGSGTGSGGGGGGGGGGGVASGLSAAAAAAGVAAGLLAAAASGANGDR 128
            ..|.:...:........||.||.                     |.......|:..::       
 Frog   237 QQHPQFQSQQSQQQQPPPGCGTD---------------------AELSPKEELMLHSS------- 273

  Fly   129 DANGGSGPGSGGGTSGGYAEHKLQLSKSGRKPRRRRTAFTHAQLAYLERKFRCQKYLSVADRSDV 193
            ||:|..|..|...::|..:|..:    ..||.||.||.||..||..|||.|:...|..|..|.::
 Frog   274 DADGKDGEDSVCLSAGSDSEEGM----LKRKQRRYRTTFTSYQLEELERAFQKTHYPDVFTREEL 334

  Fly   194 AETLNLSETQVKTWYQNRRTKWKRQNQLRLEQLRHQATMEKDFVVQDGGGAGGL-------GCCP 251
            |..|:|:|.:|:.|:||||.||::         |.:|..:..        |.||       ...|
 Frog   335 AMRLDLTEARVQVWFQNRRAKWRK---------REKAGAQTH--------APGLPFPGPLSASHP 382

  Fly   252 SG--------------LSSSFSAAAAAAAAA-----------------SNPCNFLTSAAAAAIFR 285
            .|              |.|:::|||||||||                 .:|.. |::...||:||
 Frog   383 LGPYLDASPFPPHHPALDSAWTAAAAAAAAAFPSLPPPPHGSAALPPSGSPLG-LSTFLGAAVFR 446

  Fly   286 NVGYV 290
            :..::
 Frog   447 HPAFI 451

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11085NP_572815.3 Homeobox 163..216 CDD:278475 24/52 (46%)
arxXP_002933659.1 Homeobox 305..358 CDD:365835 25/52 (48%)
OAR 500..518 CDD:367680
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.