DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11085 and arx

DIOPT Version :10

Sequence 1:NP_572815.3 Gene:CG11085 / 32213 FlyBaseID:FBgn0030408 Length:295 Species:Drosophila melanogaster
Sequence 2:XP_002933659.1 Gene:arx / 100486727 XenbaseID:XB-GENE-483940 Length:536 Species:Xenopus tropicalis


Alignment Length:112 Identity:20/112 - (17%)
Similarity:37/112 - (33%) Gaps:45/112 - (40%)


- Green bases have known domain annotations that are detailed below.


  Fly    51 SEEELQEYRQVFNMFDADRSGAIAIDELEAAIKNLGLEQTRDELDKIIDEVDQRGNHQIDFDEFC 115
            :||..:..|.::...:|:.|...|.:..|                   :||....|.|: :...|
 Frog    73 NEETAEMVRSIYRELEAEDSARRAGNATE-------------------EEVQPCCNFQV-YTYTC 117

  Fly   116 VVMRRLTMKKSNWNEVVKECFTVFDRSENGGISKKDFRFILRELGDI 162
            .|.:|               .:|:..:|.          :.||:||:
 Frog   118 DVGKR---------------ESVYSTAER----------VRREVGDV 139

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11085NP_572815.3 Homeodomain 161..217 CDD:459649 1/2 (50%)
arxXP_002933659.1 Homeodomain 302..358 CDD:459649
OAR 500..518 CDD:461067
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.