DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11085 and shox

DIOPT Version :9

Sequence 1:NP_572815.3 Gene:CG11085 / 32213 FlyBaseID:FBgn0030408 Length:295 Species:Drosophila melanogaster
Sequence 2:XP_004911874.1 Gene:shox / 100486480 XenbaseID:XB-GENE-920752 Length:334 Species:Xenopus tropicalis


Alignment Length:213 Identity:59/213 - (27%)
Similarity:81/213 - (38%) Gaps:72/213 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly   123 GANGDRDANGGSGPGSGGGTSGGY-AEHKLQLSKS----GR---KPRRRRTAFTHAQLAYLERKF 179
            ||:.|:|..  ...||...:.|.| .:.|....||    |:   |.||.||.||..||..|||.|
 Frog   113 GADSDKDKL--KDYGSTRVSEGIYECKEKRDDVKSEDEDGQTKLKQRRSRTNFTLEQLNELERLF 175

  Fly   180 RCQKYLSVADRSDVAETLNLSETQVKTWYQNRRTKWKRQ-NQLR--------------------- 222
            ....|.....|.::::.|.|||.:|:.|:||||.|.::| ||:.                     
 Frog   176 DETHYPDAFMREELSQRLGLSEARVQVWFQNRRAKCRKQENQMHKGGYGVILGTGSHLETCRVAP 240

  Fly   223 ----------LEQLRHQATMEKDFVVQDGGGAGG---------------------LGCCPSGLSS 256
                      .:|::.|..:|        |.|..                     .|...:.|:.
 Frog   241 YVNMGALRMPFQQVQAQLQLE--------GVAHAHPHLHPHLAAHAPYLMFPPPPFGLPIASLAD 297

  Fly   257 SFSAAAAAAAAA-SNPCN 273
            :.||||..|||| ||..|
 Frog   298 TASAAAVVAAAAKSNSKN 315

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11085NP_572815.3 Homeobox 163..216 CDD:278475 23/52 (44%)
shoxXP_004911874.1 Homeobox 159..213 CDD:365835 23/53 (43%)
OAR 314..330 CDD:367680 1/2 (50%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.