DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11085 and nkx1-2

DIOPT Version :9

Sequence 1:NP_572815.3 Gene:CG11085 / 32213 FlyBaseID:FBgn0030408 Length:295 Species:Drosophila melanogaster
Sequence 2:XP_002937845.1 Gene:nkx1-2 / 100486193 XenbaseID:XB-GENE-854960 Length:246 Species:Xenopus tropicalis


Alignment Length:133 Identity:53/133 - (39%)
Similarity:66/133 - (49%) Gaps:34/133 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   134 SGPGSGGGTSGGYAEHKLQL----------SKSGRKPRRRRTAFTHAQLAYLERKFRCQKYLSVA 188
            |||.....||.|..|...:.          |.:..||||.|||||:.||..||.:||..:||||.
 Frog    64 SGPEIKAETSPGEPEELPEKEENQETQNVPSVTNCKPRRARTAFTYEQLVALESRFRSSRYLSVC 128

  Fly   189 DRSDVAETLNLSETQVKTWYQNRRTKWKRQNQLRLEQLRHQATMEKDFVVQDGGGAGGLGC---- 249
            :|..:|.||:|:|||||.|:||||||||:|..:                    |...|.||    
 Frog   129 ERLSLALTLHLTETQVKIWFQNRRTKWKKQQPI--------------------GSLEGRGCSIQN 173

  Fly   250 CPS 252
            ||:
 Frog   174 CPT 176

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11085NP_572815.3 Homeobox 163..216 CDD:278475 32/52 (62%)
nkx1-2XP_002937845.1 Homeobox 104..157 CDD:365835 33/52 (63%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.