DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11085 and hoxc3

DIOPT Version :9

Sequence 1:NP_572815.3 Gene:CG11085 / 32213 FlyBaseID:FBgn0030408 Length:295 Species:Drosophila melanogaster
Sequence 2:XP_002936696.1 Gene:hoxc3 / 100190990 XenbaseID:XB-GENE-5997986 Length:394 Species:Xenopus tropicalis


Alignment Length:135 Identity:43/135 - (31%)
Similarity:66/135 - (48%) Gaps:26/135 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   161 RRRRTAFTHAQLAYLERKFRCQKYLSVADRSDVAETLNLSETQVKTWYQNRRTKWKRQNQLRLEQ 225
            :|.|||:|::||..||::|...:||....|.::|:.|||||.|:|.|:||||.|:|:.::     
 Frog   164 KRARTAYTNSQLVELEKEFHFNRYLCRPRRLEMAKLLNLSERQIKIWFQNRRMKFKKDHK----- 223

  Fly   226 LRHQATMEKDFVVQDGGGAGGLGCCPSGLSSSFSAAA---AAAAAASNPCNFLTSAAAAAIFRNV 287
                           |.|.||   .|.|||.|.|.:.   :........|.:....|..|..::.
 Frog   224 ---------------GKGGGG---SPGGLSPSSSPSLMPYSGNLPLDGDCGYEVPMATGAYNKSP 270

  Fly   288 GYVHG 292
            |.::|
 Frog   271 GNMYG 275

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11085NP_572815.3 Homeobox 163..216 CDD:278475 26/52 (50%)
hoxc3XP_002936696.1 Homeobox 167..220 CDD:395001 26/52 (50%)
DUF4074 335..392 CDD:404218
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.