DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11085 and pou5f3.3

DIOPT Version :9

Sequence 1:NP_572815.3 Gene:CG11085 / 32213 FlyBaseID:FBgn0030408 Length:295 Species:Drosophila melanogaster
Sequence 2:NP_001123836.1 Gene:pou5f3.3 / 100170593 XenbaseID:XB-GENE-5903504 Length:423 Species:Xenopus tropicalis


Alignment Length:113 Identity:31/113 - (27%)
Similarity:51/113 - (45%) Gaps:14/113 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly   149 HKLQLSKSGRKPRRRRTAFTHAQLAYLERKFRCQKYLSVADRSDVAETLNLSETQVKTWYQNRRT 213
            ||.||.:..|| |:.||.|.......||..|.|.:.....:.:::|:.|.|.:..|:.|:.|||.
 Frog   291 HKAQLEEQNRK-RKMRTCFDSVLKGRLEGHFMCNQKPGARELAEIAKELGLEKDVVRVWFCNRRQ 354

  Fly   214 KWKRQNQLRLEQLRHQATMEKDFVVQDGGGAGGLGCCPSGLSSSFSAA 261
            |.|.::::         :...:||    |||..:......:|..:..|
 Frog   355 KEKSKSRM---------SKAHEFV----GGASPVPSPAEHISQDYGLA 389

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11085NP_572815.3 Homeobox 163..216 CDD:278475 16/52 (31%)
pou5f3.3NP_001123836.1 PTZ00395 <7..>177 CDD:185594
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 85..211
POU 207..281 CDD:197673
Homeobox 305..357 CDD:365835 16/51 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.