Sequence 1: | NP_572815.3 | Gene: | CG11085 / 32213 | FlyBaseID: | FBgn0030408 | Length: | 295 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001315326.1 | Gene: | pax3b / 100150137 | ZFINID: | ZDB-GENE-080917-53 | Length: | 469 | Species: | Danio rerio |
Alignment Length: | 195 | Identity: | 54/195 - (27%) |
---|---|---|---|
Similarity: | 70/195 - (35%) | Gaps: | 71/195 - (36%) |
- Green bases have known domain annotations that are detailed below.
Fly 118 AAAASGANGDRDANGGSGPGSGGGTSGGYAEHKLQLSKSGRKPRRRRTAFTHAQLAYLERKFRCQ 182
Fly 183 KYLSVADRSDVAETLNLSETQVKTWYQNRRTKWKRQ---NQL----------------------- 221
Fly 222 -------------------RLEQLRHQATMEKDFVVQDGGGA---GGLGCCPS------GLSSSF 258
Fly 259 258 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG11085 | NP_572815.3 | Homeobox | 163..216 | CDD:278475 | 20/52 (38%) |
pax3b | NP_001315326.1 | None |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 1 | 1.000 | - | - | ||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
ZFIN | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.910 |