DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11085 and Rhox3c

DIOPT Version :9

Sequence 1:NP_572815.3 Gene:CG11085 / 32213 FlyBaseID:FBgn0030408 Length:295 Species:Drosophila melanogaster
Sequence 2:NP_001095927.3 Gene:Rhox3c / 100135654 MGIID:3770268 Length:215 Species:Mus musculus


Alignment Length:206 Identity:54/206 - (26%)
Similarity:81/206 - (39%) Gaps:52/206 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    38 EDRSTPDSTAAGCQQEL-------LLSHHHRRFTHHDESSVESCLSATRGPGSGTGSGGGGGGGG 95
            :|......:..||:.::       :|.....| ...|...|||.|.||...|.|           
Mouse    40 QDYHRASRSVYGCETKMDSTQGTKVLPAEEAR-NEEDGGQVESALGATAARGRG----------- 92

  Fly    96 GGGVASGLSAAAAAAGVAAGLLAAAASGANGDRDANGGSGPGSGGGTSGG-------------YA 147
                ...|:..:.||...|||:         :.|.|     ...|||.||             :.
Mouse    93 ----KEALNGESPAAAGTAGLV---------EEDRN-----KEDGGTKGGEKNEQEVREQIPEHV 139

  Fly   148 EHKLQLSKSGRK-PRRR-RTAFTHAQLAYLERKFRCQKYLSVADRSDVAETLNLSETQVKTWYQN 210
            |.:...:::.|: |||| ...||..||..|||.||...:||:..|..:|..:.::|..||.|:|.
Mouse   140 EGESDQAEAPRQVPRRRLHHRFTQWQLDELERIFRMNYFLSLEARKQLARWMGVNEAIVKRWFQK 204

  Fly   211 RRTKWKRQNQL 221
            ||.:::...:|
Mouse   205 RREQYRWYKRL 215

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11085NP_572815.3 Homeobox 163..216 CDD:278475 21/53 (40%)
Rhox3cNP_001095927.3 homeodomain 155..211 CDD:238039 22/55 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.