DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11085 and hoxb5

DIOPT Version :9

Sequence 1:NP_572815.3 Gene:CG11085 / 32213 FlyBaseID:FBgn0030408 Length:295 Species:Drosophila melanogaster
Sequence 2:NP_001094494.1 Gene:hoxb5 / 100113366 XenbaseID:XB-GENE-1005991 Length:258 Species:Xenopus tropicalis


Alignment Length:136 Identity:43/136 - (31%)
Similarity:68/136 - (50%) Gaps:21/136 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   107 AAAAGVAAGLLAAAASGANGDRDANG-------------GSGPGSGGGTSGGYAE-----HKLQL 153
            |.:||.:|.......:.|:.:.:.:.             .|.||: .||.|...:     .||.:
 Frog   111 ATSAGSSAQFTEVEETSASSETEESSTPRSSAPPRALQENSSPGA-AGTDGQNPQIFPWMRKLHI 174

  Fly   154 S--KSGRKPRRRRTAFTHAQLAYLERKFRCQKYLSVADRSDVAETLNLSETQVKTWYQNRRTKWK 216
            :  .:|...:|.|||:|..|...||::|...:||:...|.::|..|.|||.|:|.|:||||.|||
 Frog   175 NHDMTGPDGKRARTAYTRYQTLELEKEFHFNRYLTRRRRIEIAHALCLSERQIKIWFQNRRMKWK 239

  Fly   217 RQNQLR 222
            :.|:|:
 Frog   240 KDNKLK 245

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11085NP_572815.3 Homeobox 163..216 CDD:278475 24/52 (46%)
hoxb5NP_001094494.1 Homeobox 187..240 CDD:365835 25/52 (48%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.