DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11085 and vsx1

DIOPT Version :9

Sequence 1:NP_572815.3 Gene:CG11085 / 32213 FlyBaseID:FBgn0030408 Length:295 Species:Drosophila melanogaster
Sequence 2:NP_001093670.1 Gene:vsx1 / 100101658 XenbaseID:XB-GENE-853166 Length:344 Species:Xenopus tropicalis


Alignment Length:285 Identity:66/285 - (23%)
Similarity:92/285 - (32%) Gaps:105/285 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 SKSFLIRDLLGDLINRRQTDSELELSNDDSDIDIEDRSTPDSTAAGCQQELLLSHHHRRFTHHDE 68
            ||.|.|.||||       .::||:               |.|.                      
 Frog    36 SKGFAITDLLG-------LEAELQ---------------PPSL---------------------- 56

  Fly    69 SSVESCLSATRGPGSGTGSGGGGGGGGGGGVASGLSAAAAAAGVAAGLLAAAAS----GAN---- 125
             |:.||    .|||:..|               |:|.|..:..:..|.|...||    |..    
 Frog    57 -SLPSC----EGPGASLG---------------GVSLANGSLPLGLGFLCGFASQQPPGTTCLLP 101

  Fly   126 -----------------GDRDANGGSGPGSGGGTSGGYAEHKLQLSKSGRKPRRRRTAFTHAQLA 173
                             .|:.....|...|   ..|...:.|...|::.||.||.||.||..||.
 Frog   102 THIPFLQPRADHQYLHASDKHKENISDDDS---LLGDKNDLKASSSQAKRKKRRHRTVFTAHQLE 163

  Fly   174 YLERKFRCQKYLSVADRSDVAETLNLSETQVKTWYQNRRTKWKRQNQ------------LRLEQL 226
            .||:.|....|..|..|..:|....|.|.:::.|:||||.||:::.:            |....:
 Frog   164 ELEKAFNEAHYPDVYAREMLALKTELPEDRIQVWFQNRRAKWRKREKCWGRSSVMAEYGLYGAMV 228

  Fly   227 RHQATMEKDFVVQDGGGAGGLGCCP 251
            ||...:.:..:.....|..| .|.|
 Frog   229 RHSIPLPESIINSAKNGLVG-SCAP 252

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11085NP_572815.3 Homeobox 163..216 CDD:278475 21/52 (40%)
vsx1NP_001093670.1 Homeobox 153..207 CDD:365835 22/53 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.