DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11085 and barx2

DIOPT Version :9

Sequence 1:NP_572815.3 Gene:CG11085 / 32213 FlyBaseID:FBgn0030408 Length:295 Species:Drosophila melanogaster
Sequence 2:XP_001342044.1 Gene:barx2 / 100002200 ZFINID:ZDB-GENE-081120-4 Length:268 Species:Danio rerio


Alignment Length:156 Identity:55/156 - (35%)
Similarity:72/156 - (46%) Gaps:42/156 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   158 RKPRRRRTAFTHAQLAYLERKFRCQKYLSVADRSDVAETLNLSETQVKTWYQNRRTKWK------ 216
            :||||.||.||..||..||:||:.|||||..||.|:|::|.|::.||||||||||.|||      
Zfish   117 KKPRRSRTIFTELQLLGLEKKFQKQKYLSTPDRLDLAQSLGLTQLQVKTWYQNRRMKWKKMVLKG 181

  Fly   217 ------------RQNQL-RLEQLRHQATMEKDFVVQDGGGAGGLGCCPSGLSSSFSAAAAAAAAA 268
                        ::|.: ..|::..|..||.....::                ...|........
Zfish   182 GHEAPTKPKGRPKKNSIPTTEEIEAQERMEAKLAEEE----------------RLHAEVEDEVFQ 230

  Fly   269 SNPCNFLTSAAAAAIFRNVGYVHGCP 294
            |.|.:..|||.:|     |.||  ||
Zfish   231 SQPQDLSTSATSA-----VEYV--CP 249

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11085NP_572815.3 Homeobox 163..216 CDD:278475 32/52 (62%)
barx2XP_001342044.1 Homeobox 122..175 CDD:278475 32/52 (62%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0488
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.