powered by:
Protein Alignment CG1463 and ZNHIT3
DIOPT Version :9
Sequence 1: | NP_001259489.1 |
Gene: | CG1463 / 32211 |
FlyBaseID: | FBgn0030406 |
Length: | 336 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_004764.1 |
Gene: | ZNHIT3 / 9326 |
HGNCID: | 12309 |
Length: | 155 |
Species: | Homo sapiens |
Alignment Length: | 45 |
Identity: | 17/45 - (37%) |
Similarity: | 24/45 - (53%) |
Gaps: | 4/45 - (8%) |
- Green bases have known domain annotations that are detailed below.
Fly 6 STKTRTMRLGMCEVCAAKEACYACPKCEVKTCSLPCVQIHKKELN 50
|.|..|: :|.:|..|.. |.||.|.|..||:.|.:.||::.|
Human 3 SLKCSTV---VCVICLEKPK-YRCPACRVPYCSVVCFRKHKEQCN 43
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
1 |
1.030 |
- |
avgDist |
Average_Evolutionary_Distance |
R130 |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
User_Submission |
0 | 0.000 |
Not matched by this tool. |
|
1 | 1.030 |
|
Return to query results.
Submit another query.