powered by:
Protein Alignment CG1463 and HIT1
DIOPT Version :9
Sequence 1: | NP_001259489.1 |
Gene: | CG1463 / 32211 |
FlyBaseID: | FBgn0030406 |
Length: | 336 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_012589.1 |
Gene: | HIT1 / 853516 |
SGDID: | S000003816 |
Length: | 164 |
Species: | Saccharomyces cerevisiae |
Alignment Length: | 41 |
Identity: | 14/41 - (34%) |
Similarity: | 23/41 - (56%) |
Gaps: | 0/41 - (0%) |
- Green bases have known domain annotations that are detailed below.
Fly 17 CEVCAAKEACYACPKCEVKTCSLPCVQIHKKELNCDGQRDR 57
|.:|...:..|.||||.|:.|||.|.:...|.::.:.::.|
Yeast 8 CGICRGVDGKYKCPKCGVRYCSLKCYKDAAKHVHKESEQPR 48
|
Known Domains:
Indicated by green bases in alignment.
Gene | Sequence | Domain | Region |
External ID | Identity |
CG1463 | NP_001259489.1 |
zf-HIT |
17..43 |
CDD:282314 |
12/25 (48%) |
HIT1 | NP_012589.1 |
zf-HIT |
4..34 |
CDD:398237 |
12/25 (48%) |
Hit1_C |
79..159 |
CDD:408083 |
|
Blue background indicates that the domain is not in
the aligned region.
|
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
1 |
1.030 |
- |
avgDist |
Average_Evolutionary_Distance |
R130 |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
1 | 1.030 |
|
Return to query results.
Submit another query.