DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1463 and znhit3

DIOPT Version :9

Sequence 1:NP_001259489.1 Gene:CG1463 / 32211 FlyBaseID:FBgn0030406 Length:336 Species:Drosophila melanogaster
Sequence 2:NP_956567.1 Gene:znhit3 / 393243 ZFINID:ZDB-GENE-040426-1114 Length:151 Species:Danio rerio


Alignment Length:37 Identity:14/37 - (37%)
Similarity:23/37 - (62%) Gaps:0/37 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 MCEVCAAKEACYACPKCEVKTCSLPCVQIHKKELNCD 52
            :|.||:.....|.||.|.::.||:.|.:.||::.:||
Zfish     3 LCGVCSELVPKYRCPACRIRYCSVSCFKRHKEDDSCD 39

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1463NP_001259489.1 zf-HIT 17..43 CDD:282314 10/25 (40%)
znhit3NP_956567.1 zf-HIT 1..30 CDD:282314 10/26 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R130
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.030

Return to query results.
Submit another query.