powered by:
Protein Alignment CG1463 and znhit3
DIOPT Version :9
Sequence 1: | NP_001259489.1 |
Gene: | CG1463 / 32211 |
FlyBaseID: | FBgn0030406 |
Length: | 336 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_956567.1 |
Gene: | znhit3 / 393243 |
ZFINID: | ZDB-GENE-040426-1114 |
Length: | 151 |
Species: | Danio rerio |
Alignment Length: | 37 |
Identity: | 14/37 - (37%) |
Similarity: | 23/37 - (62%) |
Gaps: | 0/37 - (0%) |
- Green bases have known domain annotations that are detailed below.
Fly 16 MCEVCAAKEACYACPKCEVKTCSLPCVQIHKKELNCD 52
:|.||:.....|.||.|.::.||:.|.:.||::.:||
Zfish 3 LCGVCSELVPKYRCPACRIRYCSVSCFKRHKEDDSCD 39
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
1 |
1.030 |
- |
avgDist |
Average_Evolutionary_Distance |
R130 |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
ZFIN |
0 | 0.000 |
Not matched by this tool. |
|
1 | 1.030 |
|
Return to query results.
Submit another query.