DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1463 and CG8204

DIOPT Version :9

Sequence 1:NP_001259489.1 Gene:CG1463 / 32211 FlyBaseID:FBgn0030406 Length:336 Species:Drosophila melanogaster
Sequence 2:NP_001286464.1 Gene:CG8204 / 36728 FlyBaseID:FBgn0034033 Length:143 Species:Drosophila melanogaster


Alignment Length:140 Identity:31/140 - (22%)
Similarity:48/140 - (34%) Gaps:23/140 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 CEVCAAKEACYACPKCEVKTCSLPCVQIHKKELNC------------DGQRDRTKFVPL--SEMT 67
            |.:|......|.|.||....||:.|.:.|:....|            ..|.:.|..||.  .:..
  Fly     4 CIICVDNLRKYKCSKCSAPYCSVACYKTHRDSPQCATRESDLKKTEVGYQEEPTLHVPFPTDDTV 68

  Fly    68 SREFMSDYCFLEECTRYAENRKSDPCKRFTHDQRNLPVTQHRMRMAAKKRNI-----NLRLQLEN 127
            :.|.:..   ||.| :...|...:|..|....|.::.:......|||.:..:     |..||:..
  Fly    69 AAEKLQQ---LENC-QELRNLLHNPHLRSLLQQIDVAINAQSAMMAAMQEPLFVEFANACLQVVE 129

  Fly   128 FSRHKENTTY 137
            .....|.|.:
  Fly   130 PMTDAERTEF 139

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1463NP_001259489.1 zf-HIT 17..43 CDD:282314 9/25 (36%)
CG8204NP_001286464.1 zf-HIT 1..30 CDD:282314 9/25 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R130
SonicParanoid 00.000 Not matched by this tool.
11.030

Return to query results.
Submit another query.