DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1463 and znhit6

DIOPT Version :9

Sequence 1:NP_001259489.1 Gene:CG1463 / 32211 FlyBaseID:FBgn0030406 Length:336 Species:Drosophila melanogaster
Sequence 2:XP_031756703.1 Gene:znhit6 / 100379897 XenbaseID:XB-GENE-941109 Length:289 Species:Xenopus tropicalis


Alignment Length:257 Identity:79/257 - (30%)
Similarity:138/257 - (53%) Gaps:23/257 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 DETSTKTRTMRLGMCEVCAAKEACYACPKCEVKTCSLPCVQIHKKELNCDGQRDRTKFVPLSEMT 67
            ||..:..|.|.|..||:|..:||.|.||:|...:||||||:.||.|:||.|.||:..|||:|:..
 Frog    15 DEPVSLKRKMSLFSCEICGGEEAKYKCPRCMKYSCSLPCVKKHKTEVNCSGLRDKAAFVPMSKFN 79

  Fly    68 SREFMSDYCFLEECTRYAENRKSDPCKRFTHDQRN--LPVTQHRMRMAAKKRNINLRLQLENFSR 130
            ....:|||.|||:.:|..:....|  :.|.....|  |.:.::|    |::.||:|::....|::
 Frog    80 EINLLSDYRFLEDTSRLVDCGARD--RLFPRHTSNKYLNLLKNR----ARRHNIDLKILPIGFTK 138

  Fly   131 HKENTTYLNWKLGRFHWRIEWLFANIPYEASLPRNVTRFVDKECNEELTLPDLVAKYVDLRHE-- 193
            .:.|:|:.:.|..||:|.::.:|         |::...:.:|...:...|..::.||:|..:.  
 Frog   139 RRVNSTFFHKKEQRFYWHLKLIF---------PQSHAEYTEKRVPDNKILNTILEKYIDSANSDP 194

  Fly   194 TAREQRKLLANHQTAGIGQLSFWLRAEGVRRSSTRCYLLDSTKTLAENLVGKTIVEFPTILV 255
            ..|::.|.....|:.    :..:::.|..:.:..|.|.||.:::|.:||..||::|:||:.|
 Frog   195 VIRQRLKTYVMSQSG----VKVYMKLEQGKCNPARFYELDPSESLLKNLENKTVIEYPTLYV 252

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1463NP_001259489.1 zf-HIT 17..43 CDD:282314 14/25 (56%)
znhit6XP_031756703.1 zf-HIT 29..55 CDD:398237 14/25 (56%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 95 1.000 Domainoid score I7292
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 - - H32378
Inparanoid 1 1.050 137 1.000 Inparanoid score I4429
OMA 1 1.010 - - QHG56026
OrthoDB 1 1.010 - - D275892at33208
OrthoFinder 1 1.000 - - FOG0002947
OrthoInspector 1 1.000 - - oto103692
Panther 1 1.100 - - LDO PTHR13483
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X3293
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
1010.080

Return to query results.
Submit another query.