DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment HOXC4 and Scr

DIOPT Version :9

Sequence 1:NP_055435.2 Gene:HOXC4 / 3221 HGNCID:5126 Length:264 Species:Homo sapiens
Sequence 2:NP_001368995.1 Gene:Scr / 40833 FlyBaseID:FBgn0003339 Length:564 Species:Drosophila melanogaster


Alignment Length:306 Identity:100/306 - (32%)
Similarity:131/306 - (42%) Gaps:101/306 - (33%)


- Green bases have known domain annotations that are detailed below.


Human    15 PKFPPCEEYSQNSYIPEHSPEYYGRT-------------RESGFQHHH----------QELYPPP 56
            |..|.....:|.:|..:.:|:....|             ::...||.|          |:|....
  Fly    88 PNTPQAHYANQAAYGGQGNPDMVDYTQLQPQRLLLQQQQQQQQQQHAHAAAAVAAQQQQQLAQQQ 152

Human    57 PPRPSYPERQ--YSCTSLQG---PGNSRGHGPA------QAGHHHPEKSQSLCEPAPLSGASASP 110
            .|:....::|  .||.....   ||.|.|.|.:      .:.:.:...||||..|..||....||
  Fly   153 HPQQQQQQQQANISCKYANDPVTPGGSGGGGVSGSNNNNNSANSNNNNSQSLASPQDLSTRDISP 217

Human   111 SPAPPAC-----------------------------------------------------SQPAP 122
            ..:|.:.                                                     |....
  Fly   218 KLSPSSVVESVARSLNKGVLGGSLAAAAAAAGLNNNHSGSGVSGGPGNVNVPMHSPGGGDSDSES 282

Human   123 DHPSSAASKQ---------PIVYPWMKKIHV--STVNPNYNGGEPKRSRTAYTRQQVLELEKEFH 176
            |..:.|.|.|         |.:|||||::|:  ||||.|   ||.||.||:|||.|.||||||||
  Fly   283 DSGNEAGSSQNSGNGKKNPPQIYPWMKRVHLGTSTVNAN---GETKRQRTSYTRYQTLELEKEFH 344

Human   177 YNRYLTRRRRIEIAHSLCLSERQIKIWFQNRRMKWKKDHRLPNTKV 222
            :||||||||||||||:|||:|||||||||||||||||:|::.:..:
  Fly   345 FNRYLTRRRRIEIAHALCLTERQIKIWFQNRRMKWKKEHKMASMNI 390

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HOXC4NP_055435.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 19..130 31/197 (16%)
Antp-type hexapeptide 135..140 3/4 (75%)
Homeobox 159..213 CDD:395001 46/53 (87%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 214..264 1/9 (11%)
ScrNP_001368995.1 Homeobox 328..381 CDD:395001 46/52 (88%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0489
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 170 1.000 Inparanoid score I4116
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000007
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR45771
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X14
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
65.960

Return to query results.
Submit another query.