DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sec16 and AT5G47480

DIOPT Version :10

Sequence 1:NP_001285158.1 Gene:Sec16 / 32209 FlyBaseID:FBgn0052654 Length:2326 Species:Drosophila melanogaster
Sequence 2:NP_199559.1 Gene:AT5G47480 / 834798 AraportID:AT5G47480 Length:1350 Species:Arabidopsis thaliana


Alignment Length:104 Identity:23/104 - (22%)
Similarity:35/104 - (33%) Gaps:35/104 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly    93 EELRIILNENTKETVAESIKTLK---------------------EKVAGQDY--------IVVCN 128
            :||..:..|.||.. :||.|.:|                     |.|..||:        :...:
plant    40 DELYRVSKEYTKNK-SESQKVIKNLIKIAVKIGVLFRHNRFSPEELVLAQDFKSKLHNGAMTAIS 103

  Fly   129 EKPAPFTAETDDFCSLQKENVHC--TILRINHKEVAEKN 165
            .....||.|.|....:..|   |  .:||:..|.:..|:
plant   104 FYEVEFTFEKDVLPDILME---CKNLLLRLVEKHLTPKS 139

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sec16NP_001285158.1 DUF4813 <279..379 CDD:435117
ACE1-Sec16-like 1371..1631 CDD:187750
AT5G47480NP_199559.1 Sec16 522..645 CDD:432885
ACE1-Sec16-like 593..943 CDD:187750
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.