DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment LIMK1 and AT1G60630

DIOPT Version :9

Sequence 1:NP_511139.2 Gene:LIMK1 / 32207 FlyBaseID:FBgn0283712 Length:1257 Species:Drosophila melanogaster
Sequence 2:NP_176262.2 Gene:AT1G60630 / 842357 AraportID:AT1G60630 Length:652 Species:Arabidopsis thaliana


Alignment Length:379 Identity:83/379 - (21%)
Similarity:135/379 - (35%) Gaps:108/379 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   350 KEKERCSSLSKLLDEQHQAQQHSAHPQLYDLSRTQSCRVVQKPQR---------------IFRAT 399
            |.:||   .||.:.|..:|:          .:.|:.....||.:|               :|...
plant   285 KREER---RSKRVAESKEAK----------TAETEEGTSDQKNKRFSWEKESEEGSVGTLVFLGR 336

  Fly   400 DLVI------------GEKLGEGFFGKVFKVTHRQSGEVMVLKELHRADEEAQRNFIKEVAVLRL 452
            |:.:            .|.||.|..|..:|.. .:||.::.:|.|..|.......|.:.:.:|..
plant   337 DITVVRYTMDDLLKASAETLGRGTLGSTYKAV-MESGFIITVKRLKDAGFPRMDEFKRHIEILGR 400

  Fly   453 LDHRHVLKFIGVLYKDKKLHMVTEYVAGGCLKELIH-----DPAQVLPWPQRVRLARDIACGMSY 512
            |.|.:::.........::..:|.:|...|.|..|||     ...:.|.|...:::|.|:|.|:.|
plant   401 LKHPNLVPLRAYFQAKEECLLVYDYFPNGSLFSLIHGSKVSGSGKPLHWTSCLKIAEDLAMGLVY 465

  Fly   513 LH-SMNIIHRDLNSMNCLVREDRSVIVADFGLARSVDAPRLPSGNMTPGGYGSGANSDAPMSPSG 576
            :| :..:.|.:|.|.|.|:..|....:.|:||:...|                      |.|...
plant   466 IHQNPGLTHGNLKSSNVLLGPDFESCLTDYGLSDLHD----------------------PYSIED 508

  Fly   577 TLRRSKSRQRRQRYTVVGNPYWMAPEMMKGLKYD-EKVDVFSFGIMLCEII-GRVEADPDFMPRN 639
            |...|.              ::.|||.....|.. :..||:|||::|.|:: ||...........
plant   509 TSAASL--------------FYKAPECRDLRKASTQPADVYSFGVLLLELLTGRTSFKDLVHKYG 559

  Fly   640 SDFS----------------LNQQEFREKFCAQCPEPFVKVAFVCCDLNPDMRP 677
            ||.|                ||..|  ||.     :..:.:|..|..:.|:.||
plant   560 SDISTWVRAVREEETEVSEELNASE--EKL-----QALLTIATACVAVKPENRP 606

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
LIMK1NP_511139.2 LIM1_LIMK 33..88 CDD:188750
LIM2_LIMK 95..148 CDD:188751
PDZ_signaling 172..271 CDD:238492
STKc_LIMK 407..693 CDD:271056 69/295 (23%)
AT1G60630NP_176262.2 LRRNT_2 23..55 CDD:285463
LRR_4 87..122 CDD:289563
leucine-rich repeat 88..110 CDD:275380
LRR_8 110..169 CDD:290566
leucine-rich repeat 111..134 CDD:275380
leucine-rich repeat 135..158 CDD:275380
leucine-rich repeat 159..180 CDD:275380
S_TKc 354..614 CDD:214567 70/297 (24%)
PKc_like 356..616 CDD:304357 69/295 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.