DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment LIMK1 and AT5G65500

DIOPT Version :9

Sequence 1:NP_511139.2 Gene:LIMK1 / 32207 FlyBaseID:FBgn0283712 Length:1257 Species:Drosophila melanogaster
Sequence 2:NP_001331744.1 Gene:AT5G65500 / 836676 AraportID:AT5G65500 Length:799 Species:Arabidopsis thaliana


Alignment Length:661 Identity:126/661 - (19%)
Similarity:230/661 - (34%) Gaps:223/661 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly   225 RIDVNLTNLHIGDRILEVN-----------GTPVSDSSVEQIDKLIR---SNEKMLQLTVEHDPV 275
            |..||...|.|.::..||.           ...:.:|.:.:.:..|:   ...:.||.|::.|  
plant   283 RRKVNEAKLMIDEKSREVKVNAERSNRAEWAISLCNSRIGEFEAWIKEESERREKLQATLDSD-- 345

  Fly   276 QVCRSC----------------SQADIQRAMSASTLILPLSTSASSVEVGRERLYKTPGEQGTKA 324
               :.|                |.|::|..:|:.  :..:..:.|..||..||:....||..|:.
plant   346 ---KECIEEAKNYVEKGKTKLHSLAELQEVLSSK--VKTMMEAKSQAEVELERVVLQRGEMITEI 405

  Fly   325 RKLRQATNASTTIPPAAGATAMTQLKEKERCSSLSKLLDEQHQAQQHSAHPQLYDLSRTQSCRVV 389
            .|||...:...        ..:...||:|...|:||  :|.....:......:...:.|.|.|:.
plant   406 EKLRSQRDVFN--------RRIEFCKEREVIGSVSK--EEVKCGYREYVAEDIRLATETYSDRLR 460

  Fly   390 QKP----QRIFRA----TDL---VIGEKLGEGFFGKVFKVTHRQSGEVMVLKELHRADEEAQRNF 443
            .|.    ..::|.    |.:   |||:.|.:..||          .:|.:|.|:.          
plant   461 LKSGGNWTNVYRGRIKHTTVAVKVIGDSLSDEAFG----------AKVKLLNEIR---------- 505

  Fly   444 IKEVAVLRLLDHRHVLKFIGVLYKDKKLHMVTEYVAGGCLKELIHDP------AQVLPWPQRVRL 502
                       |.:::...|...:..|. ::.||:..|.|::.:...      :::|.|..|:|:
plant   506 -----------HPNLVAIAGFCSQRPKC-LLFEYMHNGNLRDNLFTSQRKSRRSKILKWHDRIRI 558

  Fly   503 ARDIACGMSYLHSMN---IIHRDLNSMNCLVREDRSVIVADFGLARSVDAPRLPSGNMTPGGYGS 564
            |..:..|:.:|||:.   |:|..|.....|:  ||:::            |::.       |:|.
plant   559 AHQVCSGLGFLHSVKPKPIVHGRLTPSKILL--DRNLV------------PKIT-------GFGL 602

  Fly   565 GANSDAPMSPSGTLRRSKSRQRRQRYTVVGNPYWMAPEMMKGLKYDEKVDVFSFGIMLCEII--- 626
            ..:||                                      :.|.|.||.:||::|..::   
plant   603 IMHSD--------------------------------------QSDTKPDVMAFGVLLLHLLTGR 629

  Fly   627 ---GRVEADPDFMPRNSDFSLNQ-------QEFREKFCAQCPEPFVKVAFVCCDLNPDMRPCFET 681
               |.::|          .|:||       .:...|:..:..:.|..:|..|..:|......|.|
plant   630 NWHGLLKA----------MSMNQTSILRDLDQTAGKWPLELAKEFGALAVKCSSVNRGGNMDFST 684

  Fly   682 LHVWLQRLADDLAADRVPPERLLHEIETFQEWYASSEDALSPTSQRSLNNLDELVKSAVDSE-IS 745
                 :.:.::|...|...:    |.:|    ....|:|.:       :|:||...:.:.|. :.
plant   685 -----KEIMEELGKIREKAD----EFKT----KGGYEEATN-------SNMDEGDPNDIPSVFMC 729

  Fly   746 PVEKEKENMVIKPQDIPKSPHLGKD-FSPSGERLRD--SM--------RARRRQRFLGAQEERRN 799
            |:          .|::.|:||:..| ||...|.:::  ||        ..|...:.|......|:
plant   730 PI----------LQEVMKNPHVAADGFSYELEAIQEWLSMGHDTSPMTNLRLDYQMLTPNHTLRS 784

  Fly   800 LTPDTESKERA 810
            |..|..||..|
plant   785 LIQDWHSKRAA 795

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
LIMK1NP_511139.2 LIM1_LIMK 33..88 CDD:188750
LIM2_LIMK 95..148 CDD:188751
PDZ_signaling 172..271 CDD:238492 12/59 (20%)
STKc_LIMK 407..693 CDD:271056 52/307 (17%)
AT5G65500NP_001331744.1 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.