DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment LIMK1 and MKK6

DIOPT Version :9

Sequence 1:NP_511139.2 Gene:LIMK1 / 32207 FlyBaseID:FBgn0283712 Length:1257 Species:Drosophila melanogaster
Sequence 2:NP_200469.1 Gene:MKK6 / 835759 AraportID:AT5G56580 Length:356 Species:Arabidopsis thaliana


Alignment Length:371 Identity:83/371 - (22%)
Similarity:147/371 - (39%) Gaps:86/371 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   360 KLLDEQHQAQQHSAHPQLYDLSRTQSCRVVQKPQRIFRATDLVIGEKLGEGFFGKVFKVTHRQSG 424
            :|..::.|::|..:....::::                |.||...:.:|:|..|.|..|.|:..|
plant    45 RLTSDEKQSRQSDSKELDFEIT----------------AEDLETVKVIGKGSGGVVQLVRHKWVG 93

  Fly   425 EVMVLKELH-RADEEAQRNFIKEVAVLRLLDH-RHVLKFIGVLYKDKKLHMVTEYVAGGCLKELI 487
            :...:|.:. ...||.::..::|:.:.:.... .||:......|.:....:|.||:..|.|.::|
plant    94 KFFAMKVIQMNIQEEIRKQIVQELKINQASSQCPHVVVCYHSFYHNGAFSLVLEYMDRGSLADVI 158

  Fly   488 HDPAQVLPWPQRVRLARDIACGMSYLHS-MNIIHRDLNSMNCLVREDRSVIVADFGLARSVDAPR 551
            .....:|. |....:.:.:..|:.|||: .::||||:...|.||.....|.::|||::.|:    
plant   159 RQVKTILE-PYLAVVCKQVLLGLVYLHNERHVIHRDIKPSNLLVNHKGEVKISDFGVSASL---- 218

  Fly   552 LPSGNMTPGGYGSGANSDAPMSPSGTLRRSKSRQRRQRYTVVGNPYWMAPEMMKGLKYDEKVDVF 616
                                .|..|           ||.|.||...:|:||.:.|..||...|::
plant   219 --------------------ASSMG-----------QRDTFVGTYNYMSPERISGSTYDYSSDIW 252

  Fly   617 SFGIMLCE-IIGR---VEAD-----PDF------MPRNSDFSLNQQEFREKFCAQCPEPFVKVAF 666
            |.|:.:.| .|||   :|::     |.|      :..|...:....:|..:||:     ||.   
plant   253 SLGMSVLECAIGRFPYLESEDQQNPPSFYELLAAIVENPPPTAPSDQFSPEFCS-----FVS--- 309

  Fly   667 VCCDLNPDMRPCFETL--HVWLQRLADD------LAADRVPPERLL 704
            .|...:|..|.....|  |.::::..|.      |.....||...|
plant   310 ACIQKDPPARASSLDLLSHPFIKKFEDKDIDLGILVGTLEPPVNYL 355

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
LIMK1NP_511139.2 LIM1_LIMK 33..88 CDD:188750
LIM2_LIMK 95..148 CDD:188751
PDZ_signaling 172..271 CDD:238492
STKc_LIMK 407..693 CDD:271056 73/311 (23%)
MKK6NP_200469.1 PKc_MAPKK_plant_like 68..335 CDD:132954 74/310 (24%)
S_TKc 71..331 CDD:214567 72/303 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.