DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment LIMK1 and MEKK3

DIOPT Version :9

Sequence 1:NP_511139.2 Gene:LIMK1 / 32207 FlyBaseID:FBgn0283712 Length:1257 Species:Drosophila melanogaster
Sequence 2:NP_192587.1 Gene:MEKK3 / 826406 AraportID:AT4G08470 Length:560 Species:Arabidopsis thaliana


Alignment Length:336 Identity:79/336 - (23%)
Similarity:133/336 - (39%) Gaps:99/336 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   380 LSRTQSCRVVQKPQRIFRATDLVIGEKLGEGFFGKVFKVTHRQSGEVMVLKELHRAD-----EEA 439
            |.|.:.....:||:.|   |..:.|:.||.|.:..|::.. .:.|:...:||:...|     :|.
plant   285 LMRNKLIENFRKPEDI---TSWLKGQLLGRGSYASVYEAI-SEDGDFFAVKEVSLLDKGIQAQEC 345

  Fly   440 QRNFIKEVAVLRLLDHRHVLKFIGVLYKDKKLHMVTEYVAGGCLKELIHDPAQVLPWPQRVRLA- 503
            .:....|:|:|..|.|::::::.|......||::..|.|..|.:::|.          :|.:|: 
plant   346 IQQLEGEIALLSQLQHQNIVRYRGTAKDVSKLYIFLELVTQGSVQKLY----------ERYQLSY 400

  Fly   504 -------RDIACGMSYLHSMNIIHRDLNSMNCLVREDRSVIVADFGLARSVDAPRLPSGNMTPGG 561
                   |.|..|::|||....:|||:...|.||..:.:|.:||||||.:               
plant   401 TVVSLYTRQILAGLNYLHDKGFVHRDIKCANMLVDANGTVKLADFGLAEA--------------- 450

  Fly   562 YGSGANSDAPMSPSGTLRRSKSRQRRQRYTVVGNPYWMAPEMMKGLKYD---EKVDVFSFGIMLC 623
                :..:..||..|||                  :|||||::.....|   ...|::|.|..:.
plant   451 ----SKFNDIMSCKGTL------------------FWMAPEVINRKDSDGNGSPADIWSLGCTVL 493

  Fly   624 EI-IGRVEADPDFMPRNSDF--------------SLNQQEFREKFCAQCPEPFVKVAFVCCDLNP 673
            |: .|::... |..|..:.|              ||:.:.|               ...|..:||
plant   494 EMCTGQIPYS-DLKPIQAAFKIGRGTLPDVPDTLSLDARHF---------------ILTCLKVNP 542

  Fly   674 DMRP-CFETLH 683
            :.|| ..|.||
plant   543 EERPTAAELLH 553

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
LIMK1NP_511139.2 LIM1_LIMK 33..88 CDD:188750
LIM2_LIMK 95..148 CDD:188751
PDZ_signaling 172..271 CDD:238492
STKc_LIMK 407..693 CDD:271056 72/309 (23%)
MEKK3NP_192587.1 PKc_like 302..557 CDD:328722 73/316 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.