DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment LIMK1 and RAF1

DIOPT Version :9

Sequence 1:NP_511139.2 Gene:LIMK1 / 32207 FlyBaseID:FBgn0283712 Length:1257 Species:Drosophila melanogaster
Sequence 2:NP_001341618.1 Gene:RAF1 / 5894 HGNCID:9829 Length:668 Species:Homo sapiens


Alignment Length:698 Identity:156/698 - (22%)
Similarity:247/698 - (35%) Gaps:208/698 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   148 YGKRSCQPADAKARITTAGKPMHSIRLVEIPKDATPGLRV-DGVALDDGCPTVRITDLFCNF-FL 210
            |.:|    |....::|...|..::|| |.:|......:.| :|::|.|           |.. .|
Human    38 YQRR----ASDDGKLTDPSKTSNTIR-VFLPNKQRTVVNVRNGMSLHD-----------CLMKAL 86

  Fly   211 WLTSMAEQCCGAPYRIDVNLTNLHIGDRI-LEVNGTPVS----DSSVEQIDKLIRSNEKMLQLTV 270
            .:..:..:|| |.:|    |.:.|.|.:. |:.|....|    :..|:.:|.:..:.....:.|.
Human    87 KVRGLQPECC-AVFR----LLHEHKGKKARLDWNTDAASLIGEELQVDFLDHVPLTTHNFARKTF 146

  Fly   271 ---------------------------EHDPVQVCRSCSQADIQRAMSASTLILPLST------- 301
                                       ||...:|...|    :..:.....|:.|.||       
Human   147 LKLAFCDICQKFLLNGFRCQTCGYKFHEHCSTKVPTMC----VDWSNIRQLLLFPNSTIGDSGVP 207

  Fly   302 ------------SASSVEVGRERLYKT----------PGEQGTKARKLRQATN-----ASTTIPP 339
                        |.|.:.|..:..|.|          |..:|:.:::.|..:.     .|||:|.
Human   208 ALPSLTMRRMRESVSRMPVSSQHRYSTPHAFTFNTSSPSSEGSLSQRQRSTSTPNVHMVSTTLPV 272

  Fly   340 AAGATAMTQLKEKERCSSLSKLLDEQHQAQQHS----------------------------AHPQ 376
            .:.......|....|..|....|..:...:.||                            |..:
Human   273 DSRMIENNNLSASPRAWSRRFCLRGRDAIRSHSESASPSALSSSPNNLSPTGWSQPKTPVPAQRE 337

  Fly   377 LYDLSRTQSCRVVQ-KPQR------IFRATDLVIGEKLGEGFFGKVFKVTHRQSGEVMVLKELHR 434
            ...:|.||....:: :.||      ...|:::::..::|.|.||.|:|........|.:||.:..
Human   338 RAPVSGTQEKNKIRPRGQRDSSYYWEIEASEVMLSTRIGSGSFGTVYKGKWHGDVAVKILKVVDP 402

  Fly   435 ADEEAQRNFIKEVAVLRLLDHRHVLKFIGVLYKDKKLHMVTEYVAGGCLKELIHDPAQVLPWPQR 499
            ..|:.|. |..||||||...|.::|.|:|.:.|| .|.:||::..|..|.:.:|.........|.
Human   403 TPEQFQA-FRNEVAVLRKTRHVNILLFMGYMTKD-NLAIVTQWCEGSSLYKHLHVQETKFQMFQL 465

  Fly   500 VRLARDIACGMSYLHSMNIIHRDLNSMNCLVREDRSVIVADFGLARSVDAPRLPSGNMTPGGYGS 564
            :.:||..|.||.|||:.||||||:.|.|..:.|..:|.:.||||| :|.:               
Human   466 IDIARQTAQGMDYLHAKNIIHRDMKSNNIFLHEGLTVKIGDFGLA-TVKS--------------- 514

  Fly   565 GANSDAPMSPSGTLRRSKSRQRRQRYTVVGNPYWMAPE---MMKGLKYDEKVDVFSFGIMLCEI- 625
                          |.|.|:|..|   ..|:..|||||   |.....:..:.||:|:||:|.|: 
Human   515 --------------RWSGSQQVEQ---PTGSVLWMAPEVIRMQDNNPFSFQSDVYSYGIVLYELM 562

  Fly   626 ------------------IGRVEADPDFMPRNSDFSLNQQEFREKFCAQCPEPFVKVAFVCCDLN 672
                              :||..|.||.               .|....||:...::...|....
Human   563 TGELPYSHINNRDQIIFMVGRGYASPDL---------------SKLYKNCPKAMKRLVADCVKKV 612

  Fly   673 PDMRPCFETLHVWLQRLADDL-AADRVPPERLLHEIETFQEWYASSED 719
            .:.||.|..:...::.|...| ..:|...|..||..       |.:||
Human   613 KEERPLFPQILSSIELLQHSLPKINRSASEPSLHRA-------AHTED 653

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
LIMK1NP_511139.2 LIM1_LIMK 33..88 CDD:188750
LIM2_LIMK 95..148 CDD:188751 156/698 (22%)
PDZ_signaling 172..271 CDD:238492 23/132 (17%)
STKc_LIMK 407..693 CDD:271056 87/307 (28%)
RAF1NP_001341618.1 Raf_RBD 57..131 CDD:176411 21/90 (23%)
C1_1 139..187 CDD:278556 5/51 (10%)
STKc_C-Raf 356..638 CDD:271051 90/331 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.