DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment LIMK1 and Ilk

DIOPT Version :9

Sequence 1:NP_511139.2 Gene:LIMK1 / 32207 FlyBaseID:FBgn0283712 Length:1257 Species:Drosophila melanogaster
Sequence 2:NP_525001.2 Gene:Ilk / 53573 FlyBaseID:FBgn0028427 Length:448 Species:Drosophila melanogaster


Alignment Length:452 Identity:93/452 - (20%)
Similarity:163/452 - (36%) Gaps:121/452 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   309 GRERLYKTPGEQGTKARKLRQATNASTTIP----PAAGATAMTQLKEKER--------------- 354
            |..:|.:|..::|::.    .|||....||    .|.|...:.|:..|||               
  Fly    45 GHAKLVETLLQRGSRV----NATNMGDDIPLHLAAAHGHRDVVQMLIKERSDVNAVNEHGNTPLH 105

  Fly   355 ----------CSSLSK------LLDEQHQAQQHSAHPQLYDLSRTQSCRVVQKPQRIFR------ 397
                      |..|..      :.::........|.|.|  ..|.|.  :|:|..|..:      
  Fly   106 YACFWGYDMICEDLLNAGAQVGIANKDGHTPLEKAKPSL--AKRLQD--LVEKSGREVKVISFKE 166

  Fly   398 ------------AT----------DLVIGEKLGEGFFGKVFKVTHRQSGEVMVLKELHRADEEAQ 440
                        ||          ||.:..||.....|:.::...:::..|..:..:.:......
  Fly   167 QSWQGLKTRSRDATLSRFKGISMGDLDLHTKLSVTPSGETWRGRWQKNDVVAKILAVRQCTPRIS 231

  Fly   441 RNFIKEVAVLRLLDHRHVLKFIGVLYKDKKLHMVTEYVAGGCLKELIHD-PAQVLPWPQRVRLAR 504
            |:|.:|...||:..|.::|..||.......|..:::::....|..|:|. ...|:...|.|..|.
  Fly   232 RDFNEEFPKLRIFSHPNILPIIGACNSPPNLVTISQFMPRSSLFSLLHGATGVVVDTSQAVSFAL 296

  Fly   505 DIACGMSYLHSMNII----HRDLNSMNCLVREDRSVIVADFGLARSVDAPRLPSGNMTPGGYGSG 565
            |:|.||::|||:..|    |  |||.:.::.:|.:..:                 ||        
  Fly   297 DVARGMAFLHSLERIIPTYH--LNSHHVMIDDDLTARI-----------------NM-------- 334

  Fly   566 ANSDAPMSPSGTLRRSKSRQRRQRYTVVGNPYWMAPEMMKGLKYD---EKVDVFSFGIMLCEIIG 627
              .||..|     .:.|.|        :..|.||:||.::..:.|   |..|::||.|::.|:..
  Fly   335 --GDAKFS-----FQEKGR--------IYQPAWMSPETLQRKQADRNWEACDMWSFAILIWELTT 384

  Fly   628 RVEADPDFMPRNSDFSLNQQEFREKFCAQCPEPFVKVAFVCCDLNPDMRPCFETLHVWLQRL 689
            |.....::.|......:..:..|.|..........|:..:|.:.:|..||.|:.:...|:::
  Fly   385 REVPFAEWSPMECGMKIALEGLRVKIPPGTSTHMAKLISICMNEDPGKRPKFDMVVPILEKM 446

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
LIMK1NP_511139.2 LIM1_LIMK 33..88 CDD:188750
LIM2_LIMK 95..148 CDD:188751
PDZ_signaling 172..271 CDD:238492
STKc_LIMK 407..693 CDD:271056 63/291 (22%)
IlkNP_525001.2 ANK 28..140 CDD:238125 17/98 (17%)
ANK repeat 33..64 CDD:293786 5/22 (23%)
Ank_2 38..130 CDD:289560 17/88 (19%)
ANK repeat 66..97 CDD:293786 8/30 (27%)
ANK repeat 99..130 CDD:293786 2/30 (7%)
PK_ILK 196..446 CDD:270959 64/291 (22%)
STYKc 204..443 CDD:214568 61/280 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45445217
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.